Germany
Japan
United Kingdom
China
PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Ppp2r2c (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform (Ppp2r2c)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN414086 is the updated version of KN214086.
Ppp2r2c - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513771 is the updated version of KN313771.
Ppp2r2c (GFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform (Ppp2r2c)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp2r2c (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform (Ppp2r2c)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r2c (Myc-DDK-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform (Ppp2r2c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp2r2c (mGFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform (Ppp2r2c)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r2c (GFP-tagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform (Ppp2r2c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP2R2C (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PPP2R2C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP2R2C (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP2R2C (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP2R2C (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP2R2C (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R2C (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ppp2r2c (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (Ppp2r2c), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppp2r2c (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (Ppp2r2c), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r2c (Myc-DDK-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (Ppp2r2c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppp2r2c (mGFP-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (Ppp2r2c), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppp2r2c (GFP-tagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (Ppp2r2c), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-PPP2R2C Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp2r2c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY |
PPP2R2C (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PPP2R2C - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
PPP2R2C (untagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PPP2R2C CRISPRa kit - CRISPR gene activation of human protein phosphatase 2 regulatory subunit Bgamma
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ppp2r2c CRISPRa kit - CRISPR gene activation of mouse protein phosphatase 2, regulatory subunit B, gamma
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PPP2R2C
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PPP2R2C
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
PPP2R2C HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPP2R2C HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (PPP2R2C), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (PPP2R2C), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Ppp2r2c (untagged) - Mouse protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform (Ppp2r2c), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ppp2r2c
Ppp2r2c (untagged ORF) - Rat protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform (Ppp2r2c), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPP2R2C (untagged)-Human protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPP2R2C (untagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PPP2R2C (untagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PPP2R2C (untagged) - Homo sapiens protein phosphatase 2, regulatory subunit B, gamma (PPP2R2C), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
Active filters
Target Symbol
- PPP2R2C