Germany
Japan
United Kingdom
China
SERPINC1 (Myc-DDK-tagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 830.00
3 Weeks
Lenti ORF particles, SERPINC1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 830.00
6 Weeks
Lenti ORF particles, SERPINC1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SERPINC1 (GFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 830.00
5 Weeks
Lenti ORF particles, SERPINC1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 830.00
7 Weeks
Lenti ORF particles, SERPINC1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SERPINC1 (untagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-SERPINC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD |
Rabbit polyclonal SERPINC1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1. |
Rabbit anti-SERPINC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINC1 |
Rabbit Polyclonal Anti-Serpinc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
USD 440.00
2 Weeks
Antithrombin III (SERPINC1) goat polyclonal antibody, Serum
| Applications | ELISA, ID, IHC |
| Reactivities | Human |
| Immunogen | Antithrombin III isolated and highly purified from pooled plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SERPINC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SERPINC1 MS Standard C13 and N15-labeled recombinant protein (NP_000479)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken. |
SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
SERPINC1 / Antithrombin-III human protein, 0.1 mg
| Protein Source | Plasma |
USD 465.00
4 Weeks
Anti-SERPINC1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 15-259 amino acids of human serpin peptidase inhibitor, clade C (antithrombin), member 1 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Transient overexpression of SERPINC1 (NM_000488) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SERPINC1 (NM_000488) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SERPINC1 (NM_000488) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SERPINC1
Families
- Druggable Genome