SERPINC1 (Myc-DDK-tagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SERPINC1 (Myc-DDK-tagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 830.00
3 Weeks
Lenti ORF particles, SERPINC1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 830.00
6 Weeks
Lenti ORF particles, SERPINC1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SERPINC1 (GFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Serpinc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Serpinc1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Serpinc1 (mGFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Serpinc1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 830.00
5 Weeks
Lenti ORF particles, SERPINC1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 830.00
7 Weeks
Lenti ORF particles, SERPINC1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Serpinc1 (mGFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Serpinc1 (GFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SERPINC1 (untagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SERPINC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD |
qSTAR qPCR primer pairs against Homo sapiens gene SERPINC1
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit polyclonal SERPINC1 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1. |
Rabbit anti-SERPINC1 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPINC1 |
Rabbit Polyclonal Anti-Serpinc1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
USD 440.00
2 Weeks
Antithrombin III (SERPINC1) mouse monoclonal antibody, clone n.a, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Antithrombin III (SERPINC1) goat polyclonal antibody, Serum
Applications | ELISA, ID, IHC |
Reactivities | Human |
Immunogen | Antithrombin III isolated and highly purified from pooled plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Serpinc1 (untagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
SERPINC1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SERPINC1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SERPINC1 MS Standard C13 and N15-labeled recombinant protein (NP_000479)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken. |
SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
SERPINC1 / Antithrombin-III human protein, 0.1 mg
Protein Source | Plasma |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SERPINC1 mouse monoclonal antibody, clone OTI8D5 (formerly 8D5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
For quantitative detection of human Serpin C1 in cell culture supernates, serum, plasma (heparin, EDTA, citrate) and urine.
Assay Type | Sandwich ELISA kit of Quantitative Detection for human Serpin C1 |
Format | 8x12 divisible strips |
Reactivities | Human |
The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detect Human Antithrombin Iii/SERPINC1 with <10pg/ml sensitivity. Format: 96-well plate with removable strips. Compatible samples: cell culture supernates, serum, plasma (heparin, EDTA, citrate) and urine. This is a TMB colorimetric sandwich ELISA kit with short assay time and fast experiment set up. Antithrombin Iii/SERPINC1 tissue specificity: Found in plasma.
Assay Type | Sandwich ELISA kit of Quantitative Detection for human Serpin C1 |
Format | 8x12 divisible strips |
Reactivities | Human |
SERPINC1 CRISPRa kit - CRISPR gene activation of human serpin family C member 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Serpinc1 CRISPRa kit - CRISPR gene activation of mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SERPINC1
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Serpinc1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Serpinc1
Serpinc1 (untagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of serpin peptidase inhibitor clade C (antithrombin) member 1 (SERPINC1) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
Serpinc1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |