Germany
Japan
United Kingdom
China
SERPINC1 (Myc-DDK-tagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 830.00
3 Weeks
Lenti ORF particles, SERPINC1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 830.00
6 Weeks
Lenti ORF particles, SERPINC1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SERPINC1 (GFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Serpinc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN515602 is the updated version of KN315602.
Serpinc1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Serpinc1 (mGFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpinc1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 830.00
5 Weeks
Lenti ORF particles, SERPINC1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 830.00
7 Weeks
Lenti ORF particles, SERPINC1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Serpinc1 (mGFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpinc1 (GFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SERPINC1 (untagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-SERPINC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD |
qSTAR qPCR primer pairs against Homo sapiens gene SERPINC1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit polyclonal SERPINC1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1. |
Rabbit Polyclonal Anti-Serpinc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
USD 440.00
2 Weeks
Antithrombin III (SERPINC1) goat polyclonal antibody, Serum
| Applications | ELISA, ID, IHC |
| Reactivities | Human |
| Immunogen | Antithrombin III isolated and highly purified from pooled plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Serpinc1 (untagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SERPINC1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SERPINC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
SERPINC1 MS Standard C13 and N15-labeled recombinant protein (NP_000479)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken. |
SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
SERPINC1 / Antithrombin-III human protein, 0.1 mg
| Protein Source | Plasma |
USD 465.00
4 Weeks
For quantitative detection of human Serpin C1 in cell culture supernates, serum, plasma (heparin, EDTA, citrate) and urine.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for human Serpin C1 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detect Human Antithrombin Iii/SERPINC1 with <10pg/ml sensitivity. Format: 96-well plate with removable strips. Compatible samples: cell culture supernates, serum, plasma (heparin, EDTA, citrate) and urine. This is a TMB colorimetric sandwich ELISA kit with short assay time and fast experiment set up. Antithrombin Iii/SERPINC1 tissue specificity: Found in plasma.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for human Serpin C1 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
SERPINC1 CRISPRa kit - CRISPR gene activation of human serpin family C member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Serpinc1 CRISPRa kit - CRISPR gene activation of mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SERPINC1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Serpinc1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Serpinc1
Serpinc1 (untagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of serpin peptidase inhibitor clade C (antithrombin) member 1 (SERPINC1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Serpinc1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Active filters
Target Symbol
- SERPINC1