Products

View as table Download

Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SERPINC1 (GFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Serpinc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515602 is the updated version of KN315602.

Serpinc1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Serpinc1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Serpinc1 (mGFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Serpinc1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SERPINC1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SERPINC1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Serpinc1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Serpinc1 (mGFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Serpinc1 (GFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

SERPINC1 (untagged)-Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-SERPINC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD

qSTAR qPCR primer pairs against Homo sapiens gene SERPINC1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

Rabbit polyclonal SERPINC1 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1.

Rabbit anti-SERPINC1 Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPINC1

Rabbit Polyclonal Anti-Serpinc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV

Antithrombin III (SERPINC1) goat polyclonal antibody, Serum

Applications ELISA, ID, IHC
Reactivities Human
Immunogen Antithrombin III isolated and highly purified from pooled plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Serpinc1 (untagged) - Mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SERPINC1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SERPINC1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of serpin peptidase inhibitor, clade C (antithrombin), member 1 (SERPINC1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

SERPINC1 MS Standard C13 and N15-labeled recombinant protein (NP_000479)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken.

SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

SERPINC1 / Antithrombin-III (33-464, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

SERPINC1 / Antithrombin-III human protein, 0.1 mg

Protein Source Plasma

For quantitative detection of human Serpin C1 in cell culture supernates, serum, plasma (heparin, EDTA, citrate) and urine.

Assay Type Sandwich ELISA kit of Quantitative Detection for human Serpin C1
Format 8x12 divisible strips
Reactivities Human

The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detect Human Antithrombin Iii/SERPINC1 with <10pg/ml sensitivity. Format: 96-well plate with removable strips. Compatible samples: cell culture supernates, serum, plasma (heparin, EDTA, citrate) and urine. This is a TMB colorimetric sandwich ELISA kit with short assay time and fast experiment set up. Antithrombin Iii/SERPINC1 tissue specificity: Found in plasma.

Assay Type Sandwich ELISA kit of Quantitative Detection for human Serpin C1
Format 8x12 divisible strips
Reactivities Human

SERPINC1 CRISPRa kit - CRISPR gene activation of human serpin family C member 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Serpinc1 CRISPRa kit - CRISPR gene activation of mouse serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene SERPINC1

Application Plasmid of exact quantity for transcript copy number calculation

qPCR primer pairs and template standards against Mus musculus gene Serpinc1

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Serpinc1

Serpinc1 (untagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 (Serpinc1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of serpin peptidase inhibitor clade C (antithrombin) member 1 (SERPINC1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

Serpinc1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).