Products

cDNA Clones (11)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
NCOA62 (SNW1) (NM_012245) Human Tagged ORF Clone
RC215046

USD 420.00

In Stock

SNW1 (Myc-DDK-tagged)-Human SNW domain containing 1 (SNW1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NCOA62 (SNW1) (NM_012245) Human Tagged ORF Clone
RG215046

USD 460.00

In Stock

SNW1 (GFP-tagged) - Human SNW domain containing 1 (SNW1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NCOA62 (SNW1) (NM_012245) Human Tagged ORF Clone
RC215046L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SNW domain containing 1 (SNW1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCOA62 (SNW1) (NM_012245) Human Tagged ORF Clone
RC215046L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SNW domain containing 1 (SNW1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCOA62 (SNW1) (NM_012245) Human Tagged ORF Clone
RC215046L2

USD 620.00

3 Weeks

Lenti ORF clone of Human SNW domain containing 1 (SNW1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NCOA62 (SNW1) (NM_012245) Human Untagged Clone
SC115506

USD 760.00

In Stock

SNW1 (untagged)-Human SNW domain containing 1 (SNW1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NCOA62 (SNW1) Rabbit Polyclonal Antibody
TA306036

USD 430.00

5 Days

Rabbit Polyclonal SkiP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SkiP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human SkiP .
NCOA62 (SNW1) (NM_012245) Human Over-expression Lysate
LC402178

USD 187.00

In Stock

SNW1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCOA62 (SNW1) Rabbit Polyclonal Antibody
TA330234

USD 375.00

5 Days

Rabbit Polyclonal Anti-SKIIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE
NCOA62 (SNW1) (NM_012245) Human Over-expression Lysate
LY402178

USD 605.00

5 Days

Transient overexpression lysate of SNW domain containing 1 (SNW1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCOA62 (SNW1) (NM_012245) ICC Control Block
TB415046

USD 1,070.00

4 Weeks

Transient overexpression of SNW1 (NM_012245) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NCOA62 (SNW1) Cytosection
TS415046

USD 225.00

4 Weeks

Transient overexpression of SNW1 (NM_012245) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NCOA62 (SNW1) Cytosection
TS415046P5

USD 889.00

4 Weeks

Transient overexpression of SNW1 (NM_012245) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack