Germany
Japan
United Kingdom
China
SNW1 (Myc-DDK-tagged)-Human SNW domain containing 1 (SNW1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, SNW1 (Myc-DDK tagged) - Human SNW domain containing 1 (SNW1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SNW1 (mGFP-tagged) - Human SNW domain containing 1 (SNW1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
(Myc-DDK-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SNW1 (GFP-tagged) - Human SNW domain containing 1 (SNW1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SNW1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415046 is the updated version of KN215046.
Snw1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN516420 is the updated version of KN316420.
(GFP-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Snw1 (GFP-tagged) - Mouse SNW domain containing 1 (Snw1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of MGC:55033 (Myc-DDK-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MGC:55033 (Myc-DDK-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of MGC:55033 (mGFP-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MGC:55033 (GFP-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Snw1 (Myc-DDK-tagged) - Mouse SNW domain containing 1 (Snw1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Snw1 (Myc-DDK-tagged) - Mouse SNW domain containing 1 (Snw1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Snw1 (Myc-DDK-tagged) - Mouse SNW domain containing 1 (Snw1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Snw1 (mGFP-tagged) - Mouse SNW domain containing 1 (Snw1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Snw1 (GFP-tagged) - Mouse SNW domain containing 1 (Snw1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SNW domain containing 1 (SNW1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SNW1 (Myc-DDK tagged) - Human SNW domain containing 1 (SNW1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SNW domain containing 1 (SNW1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SNW1 (mGFP-tagged) - Human SNW domain containing 1 (SNW1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Snw1 (Myc-DDK-tagged ORF) - Rat similar to Nuclear protein SkiP (Ski-interacting protein) (RGD1561926), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Snw1 (Myc-DDK-tagged ORF) - Rat similar to Nuclear protein SkiP (Ski-interacting protein) (RGD1561926), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Snw1 (Myc-DDK-tagged ORF) - Rat similar to Nuclear protein SkiP (Ski-interacting protein) (RGD1561926), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Snw1 (mGFP-tagged ORF) - Rat similar to Nuclear protein SkiP (Ski-interacting protein) (RGD1561926), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Snw1 (GFP-tagged ORF) - Rat similar to Nuclear protein SkiP (Ski-interacting protein) (RGD1561926), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SNW domain containing 1 (SNW1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human SNW domain containing 1 (SNW1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SNW1 (untagged)-Human SNW domain containing 1 (SNW1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SNW1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-SKIIP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE |
Transient overexpression lysate of SNW domain containing 1 (SNW1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SNW1 CRISPRa kit - CRISPR gene activation of human SNW domain containing 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Snw1 CRISPRa kit - CRISPR gene activation of mouse SNW domain containing 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene SNW1
(untagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Snw1 (untagged) - Mouse SNW domain containing 1 (Snw1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Snw1
AAV ORF Particles, serotype AAV-2, (Myc-DDK-tagged) - Mouse cDNA clone MGC:55033 IMAGE:4949466, 250ul, >10^13 TU/mL
- AAV ORF®
-
Snw1 (untagged ORF) - Rat similar to Nuclear protein SkiP (Ski-interacting protein) (RGD1561926), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of SNW domain containing 1 (SNW1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Snw1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SNW1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SNW1 |
SNW1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-536 of human SNW1 (NP_036377.1). |
| Modifications | Unmodified |
Transient overexpression of SNW1 (NM_012245) in HEK293T cells paraffin embedded controls for ICC/IHC staining
SNW1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
SNW1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Snw1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- SNW1