Germany
Japan
United Kingdom
China
GAPDH (untagged)-Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadGAPDH (Myc-DDK-tagged)-Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 420.00
In Stock
G6PC (Myc-DDK-tagged)-Human glucose-6-phosphatase, catalytic subunit (G6PC)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PCK2 (Myc-DDK-tagged)-Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PCK2 (Myc-DDK-tagged)-Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GAPDH (GFP-tagged) - Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
In Stock
G6PC (GFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Lenti ORF particles, PCK2 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, PCK2 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, GAPDH (Myc-DDK tagged) - Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GAPDH (mGFP-tagged) - Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, G6PC (Myc-DDK tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, G6PC (mGFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
GAPDH (Myc-DDK tagged) - Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GAPDH (myc-DDK-tagged) - Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GAPDH (myc-DDK-tagged) - Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCK2 (GFP-tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PCK2 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PCK2 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GAPDH (Myc-DDK tagged) - Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PCK2 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PCK2 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
5 Weeks
Lenti ORF particles, G6PC (Myc-DDK tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
In Stock
Lenti ORF clone of Human glucose-6-phosphatase, catalytic subunit (G6PC), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, G6PC (mGFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 420.00
3 Weeks
G6PC (Myc-DDK tagged) - Homo sapiens glucose-6-phosphatase, catalytic subunit (G6PC), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCK2 (myc-DDK-tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PCK2 (GFP-tagged) - Human phosphoenolpyruvate carboxykinase 2 (mitochondrial) (PCK2), nuclear gene encoding mitochondrial protein, transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
G6PC (GFP-tagged) - Homo sapiens glucose-6-phosphatase, catalytic subunit (G6PC), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GAPDH (GFP-tagged) - Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 396.00
2 Weeks
Transient overexpression lysate of glucose-6-phosphatase, catalytic subunit (G6PC)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Lenti ORF clone of Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Lenti ORF clone of Human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Chicken Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH. The immunogen is located within amino acids 230 - 280 of GAPDH. |
Active filters
Families
- ES Cell Differentiation/IPS
Pathways
- Glycolysis / Gluconeogenesis
Filter by
Species
Reactivities
- Human (60)
- Mouse (51)
- Rat (43)
- Monkey (11)
- Dog (9)
- Chicken (7)
- Rabbit (7)
- Bovine (5)
- Canine (4)
- Porcine (4)
- Drosophila (3)
- Feline (3)
- Pig (3)
- Xenopus (3)
- Yeast (3)
- Zebrafish (3)
- Avian (2)
- Bacteria (2)
- Insect (2)
- Primate (2)
- All Species (1)
- Cow (1)
- Goat (1)
- Guinea Pig (1)
- Hamster (1)
- Invertebrate (1)
- Protozoa (1)