Products

Antibodies (59)
cDNA Clones (34)
Proteins (15)
Jump to Filters
View as table Download
FOXA2 (NM_153675) Human Tagged ORF Clone
RC211408

USD 420.00

In Stock

FOXA2 (Myc-DDK-tagged)-Human forkhead box A2 (FOXA2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FOXA2 (NM_021784) Human Untagged Clone
SC122913

USD 310.00

In Stock

FOXA2 (untagged)-Human forkhead box A2 (FOXA2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PDX1 (NM_000209) Human Tagged ORF Clone
RC222354

USD 420.00

In Stock

PDX1 (Myc-DDK-tagged)-Human pancreatic and duodenal homeobox 1 (PDX1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FOXA2 (NM_153675) Human Tagged ORF Clone Lentiviral Particle
RC211408L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, FOXA2 (mGFP-tagged) - Human forkhead box A2 (FOXA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDX1 (NM_000209) Human Untagged Clone
SC300025

USD 660.00

In Stock

PDX1 (untagged)-Human pancreatic and duodenal homeobox 1 (PDX1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
FOXA2 (NM_021784) Human Tagged ORF Clone
RC204066

USD 420.00

In Stock

FOXA2 (Myc-DDK-tagged)-Human forkhead box A2 (FOXA2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FOXA2 (NM_021784) Human Tagged ORF Clone
RG204066

USD 460.00

In Stock

FOXA2 (GFP-tagged) - Human forkhead box A2 (FOXA2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDX1 (NM_000209) Human Tagged ORF Clone
RG222354

USD 460.00

In Stock

PDX1 (GFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FOXA2 (NM_021784) Human Tagged ORF Clone Lentiviral Particle
RC204066L1V

USD 820.00

3 Weeks

Lenti ORF particles, FOXA2 (Myc-DDK tagged) - Human forkhead box A2 (FOXA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FOXA2 (NM_021784) Human Tagged ORF Clone Lentiviral Particle
RC204066L2V

USD 820.00

6 Weeks

Lenti ORF particles, FOXA2 (mGFP-tagged) - Human forkhead box A2 (FOXA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
FOXA2 (NM_153675) Human Tagged ORF Clone Lentiviral Particle
RC211408L1V

USD 820.00

3 Weeks

Lenti ORF particles, FOXA2 (Myc-DDK tagged) - Human forkhead box A2 (FOXA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FOXA2 (NM_153675) Human Tagged ORF Clone Lentiviral Particle
RC211408L2V

USD 820.00

6 Weeks

Lenti ORF particles, FOXA2 (mGFP-tagged) - Human forkhead box A2 (FOXA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PDX1 (NM_000209) Human Tagged ORF Clone Lentiviral Particle
RC222354L1V

USD 820.00

3 Weeks

Lenti ORF particles, PDX1 (Myc-DDK tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FOXA2 (NM_021784) Human Tagged ORF Clone
RC204066L3

USD 620.00

In Stock

Lenti ORF clone of Human forkhead box A2 (FOXA2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXA2 (NM_153675) Human Tagged ORF Clone
RG211408

USD 460.00

In Stock

FOXA2 (GFP-tagged) - Human forkhead box A2 (FOXA2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FOXA2 (NM_021784) Human Tagged ORF Clone Lentiviral Particle
RC204066L4V

USD 820.00

3 Weeks

Lenti ORF particles, FOXA2 (mGFP-tagged) - Human forkhead box A2 (FOXA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXA2 (NM_021784) Human Tagged ORF Clone Lentiviral Particle
RC204066L3V

USD 820.00

3 Weeks

Lenti ORF particles, FOXA2 (Myc-DDK tagged) - Human forkhead box A2 (FOXA2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXA2 (NM_153675) Human Tagged ORF Clone Lentiviral Particle
RC211408L3V

USD 820.00

5 Weeks

Lenti ORF particles, FOXA2 (Myc-DDK tagged) - Human forkhead box A2 (FOXA2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FOXA2 (NM_153675) Human Tagged ORF Clone
RC211408L4

USD 620.00

In Stock

Lenti ORF clone of Human forkhead box A2 (FOXA2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDX1 (NM_000209) Human Tagged ORF Clone
RC222354L3

USD 620.00

3 Weeks

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDX1 (NM_000209) Human Tagged ORF Clone Lentiviral Particle
RC222354L3V

USD 820.00

7 Weeks

Lenti ORF particles, PDX1 (Myc-DDK tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDX1 (NM_000209) Human Tagged ORF Clone
RC222354L4

USD 620.00

In Stock

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDX1 (NM_000209) Human Tagged ORF Clone Lentiviral Particle
RC222354L4V

USD 820.00

3 Weeks

Lenti ORF particles, PDX1 (mGFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDX1 (NM_000209) Human Tagged Lenti ORF Clone
RC222354L2

USD 768.00

In Stock

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FOXA2 (NM_153675) Human Over-expression Lysate
LY407005

USD 605.00

In Stock

Transient overexpression lysate of forkhead box A2 (FOXA2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FOXA2 (NM_021784) Human Untagged Clone
SC327867

USD 760.00

In Stock

FOXA2 (untagged)-Human forkhead box A2 (FOXA2) transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
FOXA2 (NM_021784) Human Tagged ORF Clone
RC204066L1

USD 768.00

In Stock

Lenti ORF clone of Human forkhead box A2 (FOXA2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FOXA2 (NM_153675) Human Tagged ORF Clone
RC211408L1

USD 768.00

In Stock

Lenti ORF clone of Human forkhead box A2 (FOXA2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FOXA2 Rabbit Monoclonal Antibody [Clone ID: EPR4466]
TA307001

USD 512.00

In Stock

Rabbit monoclonal antibody against HNF 3 Beta(clone EPR4466)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FOXA2 (NM_153675) Human Untagged Clone
SC306637

USD 770.00

In Stock

FOXA2 (untagged)-Human forkhead box A2 (FOXA2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PDX1 (NM_000209) Human Tagged ORF Clone
RC222354L1

USD 620.00

In Stock

Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PDX1 (NM_000209) Human Tagged ORF Clone Lentiviral Particle
RC222354L2V

USD 1,020.00

3 Weeks

Lenti ORF particles, PDX1 (mGFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FOXA2 (453-463) Goat Polyclonal Antibody
AP23027PU-N

USD 440.00

2 Weeks

FOXA2 (453-463) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus
Immunogen Synthetic peptide from C-terminus of human FOXA2
PDX1 (NM_000209) Human Over-expression Lysate
LY400074

USD 396.00

In Stock

Transient overexpression lysate of pancreatic and duodenal homeobox 1 (PDX1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDX1 Rabbit Polyclonal Antibody
TA327504

USD 275.00

3 Weeks

Rabbit anti-PDX1 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human PDX1
FOXA2 Rabbit Polyclonal Antibody
TA345338

USD 410.00

5 Days

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the N terminal of human FOXA2. Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA
FOXA2 Rabbit Polyclonal Antibody
TA345339

USD 410.00

5 Days

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the C terminal of human FOXA2. Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS
PDX1 (NM_000209) Human Over-expression Lysate
LC400074

USD 121.00

In Stock

PDX1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
FOXA2 (NM_021784) Human Tagged ORF Clone
RC204066L2

USD 620.00

3 Weeks

Lenti ORF clone of Human forkhead box A2 (FOXA2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FOXA2 (NM_153675) Human Tagged ORF Clone
RC211408L2

USD 620.00

3 Weeks

Lenti ORF clone of Human forkhead box A2 (FOXA2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FOXA2 Goat Polyclonal Antibody
TA302874

USD 375.00

5 Days

Goat Polyclonal Antibody against FOXA2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1.
FOXA2 Rabbit Polyclonal Antibody
TA322223

USD 345.00

In Stock

Anti-FOXA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2
FOXA2 Rabbit Polyclonal Antibody
TA324382

USD 450.00

5 Days

Rabbit polyclonal FOXA2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2.
FOXA2 Rabbit Polyclonal Antibody
TA324463

USD 450.00

5 Days

Rabbit polyclonal FOXA2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2.
PDX1 Rabbit Polyclonal Antibody
TA336928

USD 424.00

5 Days

Rabbit Polyclonal PDX-1/IPF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human PDX1 protein (between residues 100-200) [UniProt P52945]
FOXA2 (NM_153675) Human Over-expression Lysate
LC407005

USD 187.00

In Stock

FOXA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FOXA2 Rabbit Polyclonal Antibody
TA319660

USD 430.00

5 Days

Rabbit Polyclonal FOXA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FOXA2 antibody was raised against a 16 amino acid peptide near the center of human FOXA2 .
PDX1 Rabbit Polyclonal Antibody
TA324981

USD 450.00

5 Days

Rabbit polyclonal IPF Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF.