Products

Antibodies (38)
cDNA Clones (25)
Proteins (21)
Jump to Filters
View as table Download
EGF (NM_001963) Human Untagged Clone
SC127840

USD 310.00

In Stock

EGF (untagged)-Human epidermal growth factor (EGF), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
EGF (NM_001963) Human Tagged ORF Clone
RC210817

USD 1,270.00

In Stock

EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EGF (NM_001963) Human Recombinant Protein
TP310817

USD 823.00

In Stock

Recombinant protein of human epidermal growth factor (beta-urogastrone) (EGF)

Tag C-Myc/DDK
Expression Host HEK293T
EGF (NM_001963) Human Tagged ORF Clone Lentiviral Particle
RC210817L1V

USD 1,670.00

3 Weeks

Lenti ORF particles, EGF (Myc-DDK tagged) - Human epidermal growth factor (EGF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
EGF (NM_001963) Human Tagged ORF Clone Lentiviral Particle
RC210817L2V

USD 1,670.00

6 Weeks

Lenti ORF particles, EGF (mGFP-tagged) - Human epidermal growth factor (EGF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
EGF (NM_001178130) Human Tagged ORF Clone
RG230667

USD 1,340.00

6 Weeks

EGF (GFP-tagged) - Human epidermal growth factor (EGF), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EGF (NM_001963) Human Tagged ORF Clone
RC210817L3

USD 1,470.00

3 Weeks

Lenti ORF clone of Human epidermal growth factor (EGF), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001963) Human Tagged ORF Clone Lentiviral Particle
RC210817L3V

USD 1,670.00

7 Weeks

Lenti ORF particles, EGF (Myc-DDK tagged) - Human epidermal growth factor (EGF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001963) Human Tagged ORF Clone
RC210817L4

USD 1,470.00

In Stock

Lenti ORF clone of Human epidermal growth factor (EGF), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001963) Human Tagged ORF Clone Lentiviral Particle
RC210817L4V

USD 1,670.00

3 Weeks

Lenti ORF particles, EGF (mGFP-tagged) - Human epidermal growth factor (EGF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178131) Human Tagged ORF Clone
RC230666

USD 1,220.00

5 Weeks

EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EGF (NM_001178131) Human Tagged ORF Clone
RC230666L3

USD 1,420.00

5 Weeks

Lenti-ORF clone of EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178131) Human Tagged ORF Clone Lentiviral Particle
RC230666L3V

USD 1,620.00

8 Weeks

Lenti ORF particles, EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178131) Human Tagged ORF Clone
RC230666L4

USD 1,420.00

5 Weeks

Lenti-ORF clone of EGF (mGFP-tagged)-Human epidermal growth factor (EGF), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178131) Human Tagged ORF Clone Lentiviral Particle
RC230666L4V

USD 1,620.00

8 Weeks

Lenti ORF particles, EGF (mGFP-tagged)-Human epidermal growth factor (EGF), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178130) Human Tagged ORF Clone
RC230667

USD 1,220.00

5 Weeks

EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
EGF (NM_001178130) Human Tagged ORF Clone
RC230667L3

USD 1,420.00

5 Weeks

Lenti-ORF clone of EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178130) Human Tagged ORF Clone Lentiviral Particle
RC230667L3V

USD 1,620.00

8 Weeks

Lenti ORF particles, EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178130) Human Tagged ORF Clone
RC230667L4

USD 1,420.00

5 Weeks

Lenti-ORF clone of EGF (mGFP-tagged)-Human epidermal growth factor (EGF), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001178130) Human Tagged ORF Clone Lentiviral Particle
RC230667L4V

USD 1,620.00

8 Weeks

Lenti ORF particles, EGF (mGFP-tagged)-Human epidermal growth factor (EGF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EGF (NM_001963) Human Tagged ORF Clone
RG210817

USD 1,400.00

3 Weeks

EGF (GFP-tagged) - Human epidermal growth factor (EGF), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EGF (NM_001178131) Human Tagged ORF Clone
RG230666

USD 1,340.00

6 Weeks

EGF (GFP-tagged) - Human epidermal growth factor (EGF), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EGF Mouse Monoclonal Antibody [Clone ID: S-21]
AM09146PU-N

USD 540.00

2 Weeks

EGF mouse monoclonal antibody, clone S-21, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
EGF (NM_001963) Human Tagged Lenti ORF Clone
RC210817L1

USD 1,824.00

In Stock

Lenti ORF clone of Human epidermal growth factor (EGF), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EGF Rabbit Polyclonal Antibody
TA328292

USD 285.00

2 Weeks

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF
EGF (NM_001963) Human Recombinant Protein
TP723068

USD 140.00

5 Days

Purified recombinant protein of Human epidermal growth factor (EGF), transcript variant 1.

Tag Tag Free
Expression Host E. coli
EGF Mouse Monoclonal Antibody [Clone ID: KT2]
AM20815PU-N

USD 560.00

In Stock

EGF mouse monoclonal antibody, clone KT2, Aff - Purified

Applications ELISA
Reactivities Human
EGF (NM_001963) Human Recombinant Protein
TP723821

USD 150.00

5 Days

Purified recombinant protein of Human epidermal growth factor (EGF), transcript variant 1

Tag Tag Free
Expression Host E. coli
EGF Mouse Monoclonal Antibody [Clone ID: S-147]
AM09150PU-N

USD 540.00

In Stock

EGF mouse monoclonal antibody, clone S-147, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
EGF Human Protein
AR31147PU-N

USD 240.00

2 Weeks

EGF human recombinant protein, 0.5 mg

Expression Host E. coli
EGF Human Protein
AR31156PU-N

USD 155.00

2 Weeks

EGF human recombinant protein, 0.1 mg

Expression Host E. coli
EGF Human Protein
AR50004PU-N

USD 270.00

2 Weeks

EGF human recombinant protein, 0.5 mg

Expression Host E. coli
EGF Human Protein
AR50004PU-S

USD 155.00

2 Weeks

EGF human recombinant protein, 0.1 mg

Expression Host E. coli
EGF Rabbit Polyclonal Antibody
TA346085

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
EGF Rabbit Polyclonal Antibody
PP1002P1

USD 260.00

2 Weeks

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).
EGF Rabbit Polyclonal Antibody
PP1002P2

USD 355.00

2 Weeks

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).
EGF Rabbit Polyclonal Antibody
TA347892

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF
EGF Mouse Monoclonal Antibody [Clone ID: S-146]
AM09149PU-N

USD 540.00

2 Weeks

EGF mouse monoclonal antibody, clone S-146, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
EGF Rabbit Polyclonal Antibody
AP02293SU-N

USD 515.00

2 Weeks

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.
EGF Rabbit Polyclonal Antibody
AP02293SU-S

USD 180.00

2 Weeks

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.
EGF Rabbit Polyclonal Antibody
AP20662PU-N

USD 370.00

2 Weeks

EGF rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
EGF (NM_001963) Human Over-expression Lysate
LC419624

USD 121.00

In Stock

EGF HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EGF Rabbit Polyclonal Antibody
PP1002B1

USD 260.00

2 Weeks

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).
EGF Rabbit Polyclonal Antibody
PP1002B2

USD 355.00

2 Weeks

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).
EGF (NM_001963) Human Tagged ORF Clone
RC210817L2

USD 1,470.00

3 Weeks

Lenti ORF clone of Human epidermal growth factor (EGF), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EGF Rabbit Polyclonal Antibody
TA328291

USD 285.00

5 Days

Biotinylated Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF
EGF (Center) Rabbit Polyclonal Antibody
AP51384PU-N

USD 450.00

2 Weeks

EGF (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF
EGF Mouse Monoclonal Antibody [Clone ID: S-120]
AM09147PU-N

USD 540.00

2 Weeks

EGF mouse monoclonal antibody, clone S-120, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
EGF Mouse Monoclonal Antibody [Clone ID: S-145]
AM09148PU-N

USD 540.00

2 Weeks

EGF mouse monoclonal antibody, clone S-145, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated