Products

cDNA Clones (28)
Proteins (19)
Antibodies (2)
Jump to Filters
View as table Download
KCTD1 (NM_001136205) Human Tagged ORF Clone
RC226740

USD 420.00

In Stock

KCTD1 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCTD1 (NM_198991) Human Tagged ORF Clone
RC219713

USD 420.00

In Stock

KCTD1 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCTD1 (NM_001136205) Human Tagged ORF Clone
RG226740

USD 460.00

In Stock

KCTD1 (GFP-tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (NM_001258221) Human Tagged ORF Clone
RC232304

USD 420.00

In Stock

KCTD1 (Myc-DDK tagged) - Homo sapiens potassium channel tetramerization domain containing 1 (KCTD1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (NM_198991) Human Tagged ORF Clone
RC219713L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_198991) Human Tagged ORF Clone Lentiviral Particle
RC219713L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD1 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_198991) Human Tagged ORF Clone
RC219713L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_198991) Human Tagged ORF Clone Lentiviral Particle
RC219713L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD1 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001136205) Human Tagged ORF Clone
RC226740L3

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001136205) Human Tagged ORF Clone Lentiviral Particle
RC226740L3V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD1 (Myc-DDK tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001136205) Human Tagged ORF Clone
RC226740L4

USD 620.00

3 Weeks

Lenti ORF clone of Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001136205) Human Tagged ORF Clone Lentiviral Particle
RC226740L4V

USD 820.00

6 Weeks

Lenti ORF particles, KCTD1 (mGFP-tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001142730) Human Tagged ORF Clone
RC227186

USD 750.00

4 Weeks

KCTD1 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (NM_001142730) Human Tagged ORF Clone
RC227186L3

USD 950.00

4 Weeks

Lenti-ORF clone of KCTD1 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001142730) Human Tagged ORF Clone Lentiviral Particle
RC227186L3V

USD 1,150.00

7 Weeks

Lenti ORF particles, KCTD1 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001142730) Human Tagged ORF Clone
RC227186L4

USD 950.00

4 Weeks

Lenti-ORF clone of KCTD1 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001142730) Human Tagged ORF Clone Lentiviral Particle
RC227186L4V

USD 1,150.00

7 Weeks

Lenti ORF particles, KCTD1 (mGFP-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCTD1 (NM_001258222) Human Tagged ORF Clone
RC232328

USD 420.00

2 Weeks

KCTD1 (Myc-DDK tagged) - Homo sapiens potassium channel tetramerization domain containing 1 (KCTD1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (NM_198991) Human Tagged ORF Clone
RG219713

USD 460.00

3 Weeks

KCTD1 (GFP-tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (NM_001142730) Human Tagged ORF Clone
RG227186

USD 830.00

5 Weeks

KCTD1 (GFP-tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (NM_001258221) Human Tagged ORF Clone
RG232304

USD 460.00

3 Weeks

KCTD1 (GFP-tagged) - Homo sapiens potassium channel tetramerization domain containing 1 (KCTD1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (NM_001258222) Human Tagged ORF Clone
RG232328

USD 460.00

3 Weeks

KCTD1 (GFP-tagged) - Homo sapiens potassium channel tetramerization domain containing 1 (KCTD1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCTD1 (AL831954) Human Untagged Clone
SC105831

USD 660.00

In Stock

(untagged)-Human mRNA, cDNA DKFZp451C132 (from clone DKFZp451C132)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
KCTD1 (NM_198991) Human Over-expression Lysate
LY404704

USD 396.00

5 Days

Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCTD1 Rabbit Polyclonal Antibody
TA331513

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCTD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KCTD1 Antibody is: synthetic peptide directed towards the middle region of Human KCTD1. Synthetic peptide located within the following region: EEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSG
KCTD1 Rabbit Polyclonal Antibody
TA332184

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCTD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KCTD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human KCTD1. Synthetic peptide located within the following region: NHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEY
KCTD1 (NM_198991) Human Over-expression Lysate
LC404704

USD 121.00

2 Weeks

KCTD1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCTD1 (NM_001136205) Human Over-expression Lysate
LC427853

USD 121.00

2 Weeks

KCTD1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCTD1 (NM_001136205) Human Over-expression Lysate
LY427853

USD 396.00

5 Days

Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCTD1 (NM_198991) Human Mass Spec Standard
PH319713

USD 2,055.00

3 Weeks

KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_945342)

Tag C-Myc/DDK
Expression Host HEK293
KCTD1 (NM_001136205) Human Mass Spec Standard
PH326740

USD 2,055.00

3 Weeks

KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_001129677)

Tag C-Myc/DDK
Expression Host HEK293
KCTD1 (NM_198991) Human Untagged Clone
SC312671

USD 420.00

3 Weeks

KCTD1 (untagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SC312671 is the updated version of SC122075.
KCTD1 (NM_001136205) Human Untagged Clone
SC324858

USD 420.00

3 Weeks

KCTD1 (untagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
KCTD1 (NM_001142730) Human Untagged Clone
SC326263

USD 1,760.00

7 Weeks

KCTD1 (untagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
KCTD1 (NM_001258221) Human Untagged Clone
SC330646

USD 310.00

3 Weeks

KCTD1 (untagged) - Homo sapiens potassium channel tetramerization domain containing 1 (KCTD1), transcript variant 4

Vector pCMV6 series
Tag Tag Free
KCTD1 (NM_001258222) Human Untagged Clone
SC330647

USD 310.00

3 Weeks

KCTD1 (untagged) - Homo sapiens potassium channel tetramerization domain containing 1 (KCTD1), transcript variant 5

Vector pCMV6 series
Tag Tag Free
KCTD1 (NM_198991) ICC Control Block
TB419713

USD 1,070.00

4 Weeks

Transient overexpression of KCTD1 (NM_198991) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD1 (NM_001136205) ICC Control Block
TB426740

USD 1,070.00

4 Weeks

Transient overexpression of KCTD1 (NM_001136205) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD1 (NM_001142730) ICC Control Block
TB427186

USD 1,400.00

4 Weeks

Transient overexpression of KCTD1 (NM_001142730) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD1 (NM_001258221) ICC Control Block
TB432304

USD 1,070.00

4 Weeks

Transient overexpression of KCTD1 (NM_001258221) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD1 (NM_001258222) ICC Control Block
TB432328

USD 1,070.00

4 Weeks

Transient overexpression of KCTD1 (NM_001258222) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCTD1 Cytosection
TS419713

USD 225.00

4 Weeks

Transient overexpression of KCTD1 (NM_198991) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCTD1 Cytosection
TS419713P5

USD 889.00

4 Weeks

Transient overexpression of KCTD1 (NM_198991) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCTD1 Cytosection
TS426740

USD 225.00

4 Weeks

Transient overexpression of KCTD1 (NM_001136205) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCTD1 Cytosection
TS426740P5

USD 889.00

4 Weeks

Transient overexpression of KCTD1 (NM_001136205) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCTD1 ICC Control Sections
TS427186P5

USD 889.00

4 Weeks

Transient overexpression of KCTD1 (NM_001142730) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCTD1 Cytosection
TS432304

USD 225.00

4 Weeks

Transient overexpression of KCTD1 (NM_001258221) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCTD1 Cytosection
TS432304P5

USD 889.00

4 Weeks

Transient overexpression of KCTD1 (NM_001258221) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCTD1 ICC Control Sections
TS432328P5

USD 889.00

4 Weeks

Transient overexpression of KCTD1 (NM_001258222) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack