Products

View as table Download

Lenti ORF particles, TPCN1 (mGFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

TPCN1 (GFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of TPCN1 (mGFP-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TPCN1 (mGFP-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human two pore segment channel 1 (TPCN1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TPCN1 (Myc-DDK tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human two pore segment channel 1 (TPCN1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

TPCN1 (myc-DDK-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TPCN1 (GFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

(untagged)-Human two pore segment channel 1 (cDNA clone MGC:2900 IMAGE:3010316), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

(untagged)-Human cDNA FLJ36171 fis, clone TESTI2026215, highly similar to Rattus norvegicus mRNA for voltage-gated ca channel

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-TPCN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1. Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL

TPCN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of two pore segment channel 1 (TPCN1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

TPCN1 (GFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TPCN1 (untagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SC314764 is the updated version of SC122156.

TPCN1 (untagged)-Human two pore segment channel 1 (TPCN1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

TPCN1 (untagged) - Human two pore segment channel 1 (TPCN1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of TPCN1 (NM_017901) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TPCN1 (NM_001143819) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TPCN1 (NM_001301214) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of TPCN1 (NM_017901) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TPCN1 (NM_017901) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of TPCN1 (NM_001143819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TPCN1 (NM_001143819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of TPCN1 (NM_001301214) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack