Lenti ORF particles, TPCN1 (mGFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TPCN1 (mGFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPCN1 (GFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPCN1 (Myc-DDK-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TPCN1 (mGFP-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPCN1 (mGFP-tagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human two pore segment channel 1 (TPCN1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TPCN1 (Myc-DDK tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human two pore segment channel 1 (TPCN1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TPCN1 (myc-DDK-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TPCN1 (GFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
(untagged)-Human two pore segment channel 1 (cDNA clone MGC:2900 IMAGE:3010316), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
(untagged)-Human cDNA FLJ36171 fis, clone TESTI2026215, highly similar to Rattus norvegicus mRNA for voltage-gated ca channel
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-TPCN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1. Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL |
TPCN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of two pore segment channel 1 (TPCN1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TPCN1 (GFP-tagged) - Human two pore segment channel 1 (TPCN1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TPCN1 (untagged)-Human two pore segment channel 1 (TPCN1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
TPCN1 (untagged)-Human two pore segment channel 1 (TPCN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
TPCN1 (untagged) - Human two pore segment channel 1 (TPCN1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of TPCN1 (NM_017901) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TPCN1 (NM_001143819) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TPCN1 (NM_001301214) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TPCN1 (NM_017901) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TPCN1 (NM_017901) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TPCN1 (NM_001143819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TPCN1 (NM_001143819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TPCN1 (NM_001301214) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack