PPARA (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPARA (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPARA (Myc-DDK-tagged)-Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,020.00
2 Weeks
Lenti ORF particles, PPARA (mGFP-tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,020.00
6 Weeks
Lenti ORF particles, PPARA (Myc-DDK tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
PPARA (untagged)-Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 820.00
3 Weeks
Lenti ORF particles, PPARA (Myc-DDK tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PPARA (mGFP-tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPARA (GFP-tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPARA (GFP-tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, PPARA (Myc-DDK tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, PPARA (mGFP-tagged) - Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
PPARA (untagged)-Human peroxisome proliferative activated receptor, alpha (PPARA), transcript variant 7
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPARA (untagged)-Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal PPAR a (Ab-21) antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PPAR a around the phosphorylation site of serine 21 (L-E-SP-P-L). |
Lenti ORF clone of Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Anti-PPARA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of human peroxisome proliferator-activated receptor alpha |
PPAR alpha (PPARA) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
PPAR alpha (PPARA) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 152-181 amino acids from the Central region of Human PPAR-alpha |
PPARA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-PPARA polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human PPAR alpha. |
Rabbit Polyclonal Anti-PPARA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPARA antibody: synthetic peptide directed towards the middle region of human PPARA. Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI |
Rabbit anti PPAR-gamma Polyclonal Antibody
Reactivities | Human |
Rabbit anti PPARa Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti PPARg Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPARA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PPARA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human peroxisome proliferator-activated receptor alpha (PPARA), transcript variant 5, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Anti-PPARA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha |
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |