Products

View as table Download

Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

VDR (Myc-DDK tagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

VDR (GFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

VDR (GFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

VDR (GFP-tagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

VDR (untagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Vitamin D Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor

Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

VDR (untagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Vitamin D Receptor (VDR) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

VDR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Vitamin D Receptor (Ser208) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor around the phosphorylation site of Serine 208
Modifications Phospho-specific

Rabbit polyclonal Vitamin D3 Receptor (Phospho-Ser51) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K).
Modifications Phospho-specific

Rabbit polyclonal Vitamin D3 Receptor (Ab-51) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K).

Vitamin D Receptor (VDR) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal Vitamin D Receptor (Ser208) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D Receptor around the phosphorylation site of serine 208 (D-L-SP-E-E).
Modifications Phospho-specific

Vitamin D Receptor (VDR) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 273-299 amino acids from the Central region of human VDR

Goat Polyclonal Antibody against VDR

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CGNQDYKYRVSD, from the internal region of the protein sequence according to NP_000367.1; NP_001017535.1.

Rabbit Polyclonal anti-VDR antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: LKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPV

Rabbit Polyclonal Anti-VDR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS

Rabbit Polyclonal Anti-VDR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP

VDR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

VDR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY422745 is the same product as LY425408.

VDR MS Standard C13 and N15-labeled recombinant protein (NP_000367)

Tag C-Myc/DDK
Expression Host HEK293

VDR MS Standard C13 and N15-labeled recombinant protein (NP_001017535)

Tag C-Myc/DDK
Expression Host HEK293

VDR (untagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3

Vector pCMV6 series
Tag Tag Free

Transient overexpression of VDR (NM_000376) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of VDR (NM_001017535) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of VDR (NM_001017536) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of VDR (NM_000376) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack