PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CA (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CA (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP1CA (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP1CA (untagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PPP1CA (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP1CA (GFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, PPP1CA (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, PPP1CA (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CA (Myc-DDK tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CA (mGFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP1CA (mGFP-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PPP1CA (mGFP-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Recombinant protein of human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit anti-PPP1CA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CA |
PPP1CA (1-330, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
PPP1CA (1-330, His-tag) human recombinant protein, 10 µg
Tag | His-tag |
Expression Host | E. coli |
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Purified recombinant protein of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PPP1CA (untagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Mouse Monoclonal PPP1A Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant protein of human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
PPP1A (PPP1CA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
PPP1CA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PPP1CA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 1, catalytic subunit, alpha isoform (PPP1CA), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of protein phosphatase 1, catalytic subunit, alpha isoform (PPP1CA), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse Monoclonal PPP1A Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-PPP1CA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-PPP1CA Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ppp1ca antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca. Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS |
Carrier-free (BSA/glycerol-free) PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP1CA (untagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPP1CA mouse monoclonal antibody, clone OTI6E5 (formerly 6E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of PPP1CA (NM_002708) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1CA (NM_001008709) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1CA (NM_206873) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP1CA (NM_002708) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack