Products

cDNA Clones (20)
Proteins (14)
Antibodies (8)
Jump to Filters
View as table Download
Carboxypeptidase B2 (CPB2) (NM_016413) Human Tagged ORF Clone
RC218711

USD 420.00

In Stock

CPB2 (Myc-DDK-tagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Carboxypeptidase B2 (CPB2) (NM_001872) Human Tagged ORF Clone Lentiviral Particle
RC202800L3V

USD 820.00

5 Weeks

Lenti ORF particles, CPB2 (Myc-DDK tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxypeptidase B2 (CPB2) (NM_001872) Human Tagged ORF Clone Lentiviral Particle
RC202800L4V

USD 820.00

7 Weeks

Lenti ORF particles, CPB2 (mGFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxypeptidase B2 (CPB2) (NM_016413) Human Tagged ORF Clone Lentiviral Particle
RC218711L3V

USD 820.00

6 Weeks

Lenti ORF particles, CPB2 (Myc-DDK tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxypeptidase B2 (CPB2) (NM_016413) Human Tagged ORF Clone Lentiviral Particle
RC218711L4V

USD 820.00

6 Weeks

Lenti ORF particles, CPB2 (mGFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxypeptidase B2 (CPB2) (NM_001278541) Human Tagged ORF Clone
RC237896

USD 420.00

2 Weeks

CPB2 (myc-DDK-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxypeptidase B2 (CPB2) (NM_001872) Human Tagged ORF Clone
RG202800

USD 460.00

3 Weeks

CPB2 (GFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxypeptidase B2 (CPB2) (NM_016413) Human Tagged ORF Clone
RG218711

USD 460.00

3 Weeks

CPB2 (GFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxypeptidase B2 (CPB2) (NM_001872) Human Untagged Clone
SC319723

USD 310.00

In Stock

CPB2 (untagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Carboxypeptidase B2 (CPB2) (NM_001872) Human Tagged ORF Clone
RC202800L2

USD 620.00

3 Weeks

Lenti ORF clone of Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Carboxypeptidase B2 (CPB2) (NM_016413) Human Untagged Clone
SC313122

USD 610.00

In Stock

CPB2 (untagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Carboxypeptidase B2 (CPB2) (NM_001872) Human Over-expression Lysate
LC419700

USD 121.00

In Stock

CPB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carboxypeptidase B2 (CPB2) (NM_001872) Human Over-expression Lysate
LY419700

USD 396.00

In Stock

Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
AP17235PU-N

USD 450.00

2 Weeks

Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
TA313671

USD 345.00

4 Weeks

Rabbit polyclonal anti-CPB2 antibody

Applications WB
Reactivities Human (Identities = 100%, Positives = 100%
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CPB2.
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
TA332132

USD 375.00

5 Days

Rabbit Polyclonal Anti-CPB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI
Carboxypeptidase B2 (CPB2) Mouse Monoclonal Antibody [Clone ID: OTI3D5]
CF807474

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Carboxypeptidase B2 (CPB2) (NM_016413) Human Over-expression Lysate
LC414007

USD 121.00

2 Weeks

CPB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carboxypeptidase B2 (CPB2) (NM_016413) Human Over-expression Lysate
LY414007

USD 396.00

5 Days

Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carboxypeptidase B2 (CPB2) (NM_001872) Human Mass Spec Standard
PH302800

USD 2,055.00

3 Weeks

CPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001863)

Tag C-Myc/DDK
Expression Host HEK293
Carboxypeptidase B2 (CPB2) (NM_001278541) Human Tagged ORF Clone
RG237896

USD 460.00

2 Weeks

CPB2 (GFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxypeptidase B2 (CPB2) (NM_001278541) Human Untagged Clone
SC335790

USD 390.00

2 Weeks

CPB2 (untagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Carboxypeptidase B2 (CPB2) Mouse Monoclonal Antibody [Clone ID: OTI3D5]
TA807474

USD 379.00

In Stock

CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Carboxypeptidase B2 (CPB2) (NM_001872) ICC Control Block
TB402800

USD 1,070.00

4 Weeks

Transient overexpression of CPB2 (NM_001872) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Carboxypeptidase B2 (CPB2) (NM_016413) ICC Control Block
TB418711

USD 1,070.00

4 Weeks

Transient overexpression of CPB2 (NM_016413) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Carboxypeptidase B2 (CPB2) (NM_001278541) ICC Control Block
TB437896

USD 1,070.00

4 Weeks

Transient overexpression of CPB2 (NM_001278541) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Carboxypeptidase B2 (CPB2) Cytosection
TS402800

USD 225.00

4 Weeks

Transient overexpression of CPB2 (NM_001872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Carboxypeptidase B2 (CPB2) Cytosection
TS402800P5

USD 889.00

4 Weeks

Transient overexpression of CPB2 (NM_001872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Carboxypeptidase B2 (CPB2) Cytosection
TS418711

USD 225.00

4 Weeks

Transient overexpression of CPB2 (NM_016413) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Carboxypeptidase B2 (CPB2) ICC Control Sections
TS418711P5

USD 889.00

4 Weeks

Transient overexpression of CPB2 (NM_016413) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Carboxypeptidase B2 (CPB2) ICC Control Sections
TS437896P5

USD 889.00

4 Weeks

Transient overexpression of CPB2 (NM_001278541) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack