CPB2 (Myc-DDK-tagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CPB2 (Myc-DDK-tagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CPB2 (Myc-DDK-tagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, CPB2 (Myc-DDK tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CPB2 (mGFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CPB2 (Myc-DDK tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CPB2 (mGFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CPB2 (Myc-DDK tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CPB2 (mGFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CPB2 (myc-DDK-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CPB2 (GFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CPB2 (GFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CPB2 (untagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CPB2 (untagged)-Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CPB2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2 |
Rabbit polyclonal anti-CPB2 antibody
Applications | WB |
Reactivities | Human (Identities = 100%, Positives = 100% |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPB2. |
Rabbit Polyclonal Anti-CPB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CPB2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001863)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CPB2 (GFP-tagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CPB2 (untagged) - Human carboxypeptidase B2 (plasma) (CPB2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 379.00
In Stock
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of CPB2 (NM_001872) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CPB2 (NM_016413) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CPB2 (NM_001278541) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CPB2 (NM_001872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CPB2 (NM_001872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CPB2 (NM_016413) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CPB2 (NM_016413) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CPB2 (NM_001278541) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack