Products

cDNA Clones (20)
Antibodies (16)
Proteins (13)
Jump to Filters
View as table Download
Factor VII (F7) (NM_019616) Human Tagged ORF Clone
RC213143

USD 420.00

In Stock

F7 (Myc-DDK-tagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Factor VII (F7) (NM_019616) Human Tagged ORF Clone Lentiviral Particle
RC213143L1V

USD 820.00

3 Weeks

Lenti ORF particles, F7 (Myc-DDK tagged) - Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Factor VII (F7) (NM_019616) Human Tagged ORF Clone Lentiviral Particle
RC213143L2V

USD 820.00

6 Weeks

Lenti ORF particles, F7 (mGFP-tagged) - Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Factor VII (F7) (NM_000131) Human Tagged ORF Clone
RC214841

USD 430.00

In Stock

F7 (Myc-DDK-tagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Factor VII (F7) (NM_019616) Human Tagged ORF Clone
RG213143

USD 460.00

In Stock

F7 (GFP-tagged) - Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Factor VII (F7) (NM_019616) Human Tagged ORF Clone
RC213143L3

USD 620.00

3 Weeks

Lenti ORF clone of Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_019616) Human Tagged ORF Clone Lentiviral Particle
RC213143L3V

USD 820.00

7 Weeks

Lenti ORF particles, F7 (Myc-DDK tagged) - Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_019616) Human Tagged ORF Clone
RC213143L4

USD 620.00

3 Weeks

Lenti ORF clone of Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_019616) Human Tagged ORF Clone Lentiviral Particle
RC213143L4V

USD 820.00

7 Weeks

Lenti ORF particles, F7 (mGFP-tagged) - Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_000131) Human Tagged ORF Clone
RC214841L3

USD 630.00

3 Weeks

Lenti-ORF clone of F7 (Myc-DDK-tagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_000131) Human Tagged ORF Clone Lentiviral Particle
RC214841L3V

USD 830.00

6 Weeks

Lenti ORF particles, F7 (Myc-DDK-tagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_000131) Human Tagged ORF Clone
RC214841L4

USD 630.00

3 Weeks

Lenti-ORF clone of F7 (mGFP-tagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_000131) Human Tagged ORF Clone Lentiviral Particle
RC214841L4V

USD 830.00

6 Weeks

Lenti ORF particles, F7 (mGFP-tagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor VII (F7) (NM_001267554) Human Tagged ORF Clone
RC233936

USD 420.00

5 Weeks

F7 (Myc-DDK tagged) - Homo sapiens coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Factor VII (F7) (NM_000131) Human Tagged ORF Clone
RG214841

USD 470.00

3 Weeks

F7 (GFP-tagged) - Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Factor VII (F7) (NM_001267554) Human Tagged ORF Clone
RG233936

USD 460.00

5 Weeks

F7 (GFP-tagged) - Homo sapiens coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Factor VII (F7) (NM_000131) Human Untagged Clone
SC125542

USD 780.00

In Stock

F7 (untagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Factor VII (F7) (NM_019616) Human Untagged Clone
SC109205

USD 760.00

In Stock

F7 (untagged)-Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Factor VII (F7) (+VIIa) Mouse Monoclonal Antibody [Clone ID: AD-1]
AM31848BT-N

USD 385.00

2 Weeks

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Factor VII (F7) Rabbit Polyclonal Antibody
TA313859

USD 345.00

In Stock

Rabbit polyclonal FA7 (light chain, Cleaved-Arg212) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human FA7.
Factor VII (F7) Mouse Monoclonal Antibody [Clone ID: RFFVII/2]
AM09326PU-N

USD 580.00

5 Days

Factor VII (F7) mouse monoclonal antibody, clone RFFVII/2, Aff - Purified

Applications ELISA, R, WB
Reactivities Human
Factor VII (F7) (+VIIa) Mouse Monoclonal Antibody [Clone ID: CaFVII-22]
AM31846BT-N

USD 385.00

2 Weeks

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone CaFVII-22, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Factor VII (F7) (NM_019616) Human Tagged ORF Clone
RC213143L2

USD 620.00

3 Weeks

Lenti ORF clone of Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Factor VII (F7) (+VIIa) Mouse Monoclonal Antibody [Clone ID: AA-3]
AM31847BT-N

USD 385.00

2 Weeks

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AA-3, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Factor VII (F7) (+VIIa) Mouse Monoclonal Antibody [Clone ID: AD-1]
AM31848PU-N

USD 475.00

2 Weeks

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Purified

Applications ELISA, WB
Reactivities Human
Factor VII (F7) Sheep Polyclonal Antibody
AP22826PU-N

USD 440.00

2 Weeks

Factor VII (F7) sheep polyclonal antibody, Ig Fraction

Applications ELISA, IHC
Reactivities Human
Immunogen F7 antibody was raised against human Factor VII (F. VII) purified from plasma.
Factor VII (F7) (209-444) Rabbit Polyclonal Antibody
AP23153PU-N

USD 440.00

2 Weeks

Factor VII (F7) (209-444) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 209 and 444 of Factor VII
Factor VII (F7) Rabbit Polyclonal Antibody
TA308874

USD 415.00

5 Days

Rabbit polyclonal antibody to Factor VII (coagulation factor VII (serum prothrombin conversion accelerator))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 466 of Factor VII (Uniprot ID#P08709)
Factor VII (F7) (NM_019616) Human Recombinant Protein
TP701041

USD 748.00

In Stock

Purified recombinant protein of Human coagulation factor VII (serum prothrombin conversion accelerator) (F7), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug

Tag C-His
Expression Host HEK293
Factor VII (F7) Rabbit Polyclonal Antibody
TA342830

USD 375.00

5 Days

Rabbit Polyclonal Anti-F7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F7 antibody: synthetic peptide directed towards the C terminal of human F7. Synthetic peptide located within the following region: AAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN
Factor VII (F7) Rabbit Polyclonal Antibody
TA342831

USD 375.00

5 Days

Rabbit Polyclonal Anti-F7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F7 antibody: synthetic peptide directed towards the middle region of human F7. Synthetic peptide located within the following region: RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG
Factor VII (F7) Mouse Monoclonal Antibody [Clone ID: RFF-VII/2]
TA353175L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-Factor VII Clone RFF-VII/2

Reactivities Human
Conjugation Unconjugated
Factor VII (F7) Mouse Monoclonal Antibody [Clone ID: RFF-VII/1]
TA353176L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-Factor VII Clone RFF-VII/1

Reactivities Human
Conjugation Unconjugated
Factor VII (F7) (NM_019616) Human Over-expression Lysate
LC402739

USD 187.00

2 Weeks

F7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Factor VII (F7) (NM_019616) Human Over-expression Lysate
LY402739

USD 605.00

5 Days

Transient overexpression lysate of coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Factor VII (F7) (NM_019616) Human Mass Spec Standard
PH313143

USD 2,055.00

3 Weeks

F7 MS Standard C13 and N15-labeled recombinant protein (NP_062562)

Tag C-Myc/DDK
Expression Host HEK293
Factor VII (F7) (NM_001267554) Human Untagged Clone
SC332851

USD 380.00

5 Weeks

F7 (untagged) - Homo sapiens coagulation factor VII (serum prothrombin conversion accelerator) (F7), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Factor VII (F7) Rabbit Polyclonal Antibody
TA323733

USD 345.00

In Stock

Anti-F7 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human coagulation factor VII (serum prothrombin conversion accelerator)
Factor VII (F7) Rabbit Polyclonal Antibody
TA323734

USD 345.00

4 Weeks

Anti-F7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human coagulation factor VII (serum prothrombin conversion accelerator)
Factor VII (F7) ICC Control Block
TB413143

USD 1,070.00

4 Weeks

Transient overexpression of F7 (NM_019616) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Factor VII (F7) ICC Control Block
TB414841

USD 1,080.00

4 Weeks

Transient overexpression of F7 (NM_000131) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Factor VII (F7) ICC Control Block
TB433936

USD 1,070.00

4 Weeks

Transient overexpression of F7 (NM_001267554) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Factor VII (F7) Cytosection
TS413143

USD 225.00

4 Weeks

Transient overexpression of F7 (NM_019616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Factor VII (F7) Cytosection
TS413143P5

USD 889.00

4 Weeks

Transient overexpression of F7 (NM_019616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Factor VII (F7) Cytosection
TS414841

USD 225.00

4 Weeks

Transient overexpression of F7 (NM_000131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Factor VII (F7) Cytosection
TS414841P5

USD 889.00

4 Weeks

Transient overexpression of F7 (NM_000131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Factor VII (F7) ICC Control Sections
TS433936P5

USD 889.00

4 Weeks

Transient overexpression of F7 (NM_001267554) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack