HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, HIPK1 (Myc-DDK tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, HIPK1 (mGFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (Myc-DDK tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (mGFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (Myc-DDK tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (mGFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
HIPK1 (untagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HIPK1 (untagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
HIPK1 mouse monoclonal antibody, clone 1D6
Applications | ELISA, IHC |
Reactivities | Human |
HIPK1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 892-922 amino acids from the C-terminal region of human HIPK1 |
Transient overexpression lysate of homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Anti-HIPK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIPK1 antibody: synthetic peptide directed towards the middle region of human HIPK1. Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS |
Carrier-free (BSA/glycerol-free) HIPK1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HIPK1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HIPK1 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HIPK1 mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HIPK1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HIPK1 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HIPK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HIPK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HIPK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HIPK1 (untagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HIPK1 (untagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-HIPK1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIPK1 |
HIPK1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HIPK1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |