Products

cDNA Clones (45)
Antibodies (35)
Proteins (17)
RNAi (13)
Gene Expression (8)
Jump to Filters
View as table Download
HIPK1 (NM_181358) Human Tagged ORF Clone
RC206176

USD 420.00

In Stock

HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HIPK1 (NM_198269) Human Tagged ORF Clone
RC206203

USD 420.00

In Stock

HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HIPK1 (NM_181358) Human Tagged ORF Clone Lentiviral Particle
RC206176L1V

USD 820.00

3 Weeks

Lenti ORF particles, HIPK1 (Myc-DDK tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HIPK1 (NM_181358) Human Tagged ORF Clone Lentiviral Particle
RC206176L2V

USD 820.00

6 Weeks

Lenti ORF particles, HIPK1 (mGFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HIPK1 (NM_198268) Human Tagged ORF Clone
RC216108

USD 1,270.00

6 Weeks

HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hipk1 (NM_010432) Mouse Tagged ORF Clone
MR225509

USD 1,010.00

In Stock

Hipk1 (Myc-DDK-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hipk1 (NM_001301304) Mouse Tagged ORF Clone
MR231688

USD 1,010.00

In Stock

Hipk1 (myc-DDK-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HIPK1 (NM_181358) Human Tagged ORF Clone
RG206176

USD 460.00

In Stock

HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HIPK1 Human Gene Knockout Kit (CRISPR)
KN405420

USD 1,290.00

2 Weeks

HIPK1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405420 is the updated version of KN205420.
Hipk1 Mouse Gene Knockout Kit (CRISPR)
KN507723

USD 1,290.00

2 Weeks

Hipk1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507723 is the updated version of KN307723.
Hipk1 (NM_010432) Mouse Tagged ORF Clone
MG225509

USD 1,110.00

3 Weeks

Hipk1 (GFP-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hipk1 (NM_010432) Mouse Tagged ORF Clone
MR225509L3

USD 1,210.00

3 Weeks

Lenti ORF clone of Hipk1 (Myc-DDK-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hipk1 (NM_010432) Mouse Tagged ORF Clone Lentiviral Particle
MR225509L3V

USD 1,410.00

6 Weeks

Lenti ORF particles, Hipk1 (Myc-DDK-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hipk1 (NM_010432) Mouse Tagged ORF Clone
MR225509L4

USD 1,210.00

3 Weeks

Lenti ORF clone of Hipk1 (mGFP-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hipk1 (NM_010432) Mouse Tagged ORF Clone Lentiviral Particle
MR225509L4V

USD 1,410.00

6 Weeks

Lenti ORF particles, Hipk1 (GFP-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hipk1 (NM_001301306) Mouse Tagged ORF Clone
MR231641

USD 1,220.00

5 Weeks

Hipk1 (myc-DDK-tagged) - Mouse homeodomain interacting protein kinase 1 (Hipk1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HIPK1 (NM_152696) Human Tagged ORF Clone
RC205420

USD 1,130.00

5 Weeks

HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HIPK1 (NM_152696) Human Tagged ORF Clone
RC205420L3

USD 1,330.00

5 Weeks

Lenti-ORF clone of HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_152696) Human Tagged ORF Clone Lentiviral Particle
RC205420L3V

USD 1,530.00

8 Weeks

Lenti ORF particles, HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_152696) Human Tagged ORF Clone
RC205420L4

USD 1,330.00

5 Weeks

Lenti-ORF clone of HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_152696) Human Tagged ORF Clone Lentiviral Particle
RC205420L4V

USD 1,530.00

8 Weeks

Lenti ORF particles, HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_181358) Human Tagged ORF Clone
RC206176L3

USD 620.00

3 Weeks

Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_181358) Human Tagged ORF Clone Lentiviral Particle
RC206176L3V

USD 820.00

5 Weeks

Lenti ORF particles, HIPK1 (Myc-DDK tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_181358) Human Tagged ORF Clone
RC206176L4

USD 620.00

3 Weeks

Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_181358) Human Tagged ORF Clone Lentiviral Particle
RC206176L4V

USD 820.00

7 Weeks

Lenti ORF particles, HIPK1 (mGFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198269) Human Tagged ORF Clone
RC206203L3

USD 620.00

3 Weeks

Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198269) Human Tagged ORF Clone Lentiviral Particle
RC206203L3V

USD 820.00

6 Weeks

Lenti ORF particles, HIPK1 (Myc-DDK tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198269) Human Tagged ORF Clone
RC206203L4

USD 620.00

3 Weeks

Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198269) Human Tagged ORF Clone Lentiviral Particle
RC206203L4V

USD 820.00

6 Weeks

Lenti ORF particles, HIPK1 (mGFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198268) Human Tagged ORF Clone
RC216108L3

USD 1,470.00

6 Weeks

Lenti-ORF clone of HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198268) Human Tagged ORF Clone Lentiviral Particle
RC216108L3V

USD 1,670.00

9 Weeks

Lenti ORF particles, HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198268) Human Tagged ORF Clone
RC216108L4

USD 1,470.00

6 Weeks

Lenti-ORF clone of HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_198268) Human Tagged ORF Clone Lentiviral Particle
RC216108L4V

USD 1,670.00

9 Weeks

Lenti ORF particles, HIPK1 (mGFP-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIPK1 (NM_152696) Human Tagged ORF Clone
RG205420

USD 1,240.00

6 Weeks

HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HIPK1 (NM_198269) Human Tagged ORF Clone
RG206203

USD 460.00

3 Weeks

HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HIPK1 (NM_198268) Human Tagged ORF Clone
RG216108

USD 1,400.00

6 Weeks

HIPK1 (GFP-tagged) - Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hipk1 (NM_001100986) Rat Tagged ORF Clone
RR205914

USD 2,040.00

7 Weeks

Hipk1 (Myc-DDK-tagged ORF) - Rat homeodomain interacting protein kinase 1 (Hipk1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HIPK1 (NM_181358) Human Tagged ORF Clone
RC206176L1

USD 768.00

In Stock

Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HIPK1 (NM_152696) Human Untagged Clone
SC127889

USD 310.00

In Stock

HIPK1 (untagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
HIPK1 Human shRNA Plasmid Kit (Locus ID 204851)
TL320769

USD 815.00

2 Weeks

HIPK1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
HIPK1 (NM_198269) Human Untagged Clone
SC110810

USD 310.00

In Stock

HIPK1 (untagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
HIPK1 Human siRNA Oligo Duplex (Locus ID 204851)
SR316452

USD 430.00

In Stock

HIPK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

HIPK1 (NM_181358) Human Tagged ORF Clone
RC206176L2

USD 620.00

3 Weeks

Lenti ORF clone of Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HIPK1 Mouse Monoclonal Antibody [Clone ID: 1D6]
AM21022PU-N

USD 480.00

2 Weeks

HIPK1 mouse monoclonal antibody, clone 1D6

Applications ELISA, IHC
Reactivities Human
HIPK1 (C-term) Rabbit Polyclonal Antibody
AP52049PU-N

USD 450.00

2 Weeks

HIPK1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 892-922 amino acids from the C-terminal region of human HIPK1
HIPK1 Human shRNA Plasmid Kit (Locus ID 204851)
TF320769

USD 715.00

In Stock

HIPK1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
HIPK1 (NM_198269) Human Over-expression Lysate
LY404996

USD 396.00

5 Days

Transient overexpression lysate of homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY404996 is the same product as LY430734.
HIPK1 (NM_198269) Human Over-expression Lysate
LY430734

USD 605.00

5 Days

Transient overexpression lysate of homeodomain interacting protein kinase 1 (HIPK1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HIPK1 Rabbit Polyclonal Antibody
TA342143

USD 375.00

5 Days

Rabbit polyclonal Anti-HIPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIPK1 antibody: synthetic peptide directed towards the middle region of human HIPK1. Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
HIPK1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]
CF807257

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HIPK1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated