Products

View as table Download

Rabbit Polyclonal Anti-AGER Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AGER

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: RIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGG

Rabbit anti-AGER Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AGER

RAGE (AGER) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping in the middle region of Human advanced glycosylation end-product-specific receptor(RAGE), different from the related Mouse and Rat sequences by two amino acids.

Rabbit polyclonal AGER Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This AGER antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human AGER.

Rabbit polyclonal RAGE (AGER) Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RAGE (AGER) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 348-378 amino acids from the C-terminal region of human RAGE (AGER).