Germany
Japan
United Kingdom
China
SYNPR (Myc-DDK-tagged)-Human synaptoporin (SYNPR), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SYNPR (Myc-DDK-tagged)-Human synaptoporin (SYNPR), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SYNPR (Myc-DDK tagged) - Human synaptoporin (SYNPR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SYNPR (mGFP-tagged) - Human synaptoporin (SYNPR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human synaptoporin (SYNPR), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
SYNPR (GFP-tagged) - Human synaptoporin (SYNPR), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human synaptoporin (SYNPR), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SYNPR (Myc-DDK tagged) - Human synaptoporin (SYNPR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human synaptoporin (SYNPR), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SYNPR (mGFP-tagged) - Human synaptoporin (SYNPR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human synaptoporin (SYNPR), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SYNPR (Myc-DDK tagged) - Human synaptoporin (SYNPR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human synaptoporin (SYNPR), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SYNPR (mGFP-tagged) - Human synaptoporin (SYNPR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SYNPR (GFP-tagged) - Human synaptoporin (SYNPR), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SYNPR guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic C-terminal peptide CHSSGQRYLSDPMEKHS (corresponding to a part of the cytoplasmic carboxy terminus) conjugated to KLH. |
Lenti ORF clone of Human synaptoporin (SYNPR), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human synaptoporin (SYNPR), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SYNPR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-SYNPR Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Synpr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV |
SYNPR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of synaptoporin (SYNPR), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_653243)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SYNPR MS Standard C13 and N15-labeled recombinant protein (NP_001123475)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
SYNPR (untagged)-Human synaptoporin (SYNPR), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SYNPR (untagged)-Human synaptoporin (SYNPR), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of SYNPR (NM_144642) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SYNPR (NM_001130003) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SYNPR (NM_144642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SYNPR (NM_144642) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SYNPR (NM_001130003) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SYNPR (NM_001130003) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SYNPR
Families
- Secreted Protein