Lenti ORF particles, CTBP2 (Myc-DDK tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CTBP2 (Myc-DDK tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CTBP2 (Myc-DDK-tagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTBP2 (Myc-DDK-tagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CTBP2 (Myc-DDK tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CTBP2 (mGFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CTBP2 (GFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTBP2 (Myc-DDK-tagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTBP2 (myc-DDK-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTBP2 (myc-DDK-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CTBP2 (Myc-DDK-tagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP2 (Myc-DDK-tagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CTBP2 (mGFP-tagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP2 (mGFP-tagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human C-terminal binding protein 2 (CTBP2), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP2 (Myc-DDK tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human C-terminal binding protein 2 (CTBP2), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP2 (mGFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human C-terminal binding protein 2 (CTBP2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP2 (mGFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CTBP2 (GFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTBP2 (GFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human C-terminal binding protein 2 (CTBP2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human C-terminal binding protein 2 (CTBP2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CTBP2 (untagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CTBP2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Lenti ORF clone of Human C-terminal binding protein 2 (CTBP2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CTBP2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human CTBP2. |
CTBP2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal antibody to CtBP2 (C-terminal binding protein 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 197 and 417 of CtBP2 (Uniprot ID#P56545) |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE |
Rabbit polyclonal anti-CtBP2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CtBP2. |
Carrier-free (BSA/glycerol-free) CTBP2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CTBP2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001077383)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001320)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CTBP2 (GFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTBP2 (GFP-tagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTBP2 (untagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CTBP2 (untagged)-Human C-terminal binding protein 2 (CTBP2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CTBP2 (untagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
CTBP2 (untagged) - Human C-terminal binding protein 2 (CTBP2), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
Anti-CTBP2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2 |
Anti-CTBP2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2 |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CTBP2 |
CTBP2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTBP2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |