Products

cDNA Clones (8)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RC203477

USD 420.00

In Stock

GTF2E2 (Myc-DDK-tagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RG203477

USD 460.00

In Stock

GTF2E2 (GFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RC203477L3

USD 620.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone Lentiviral Particle
RC203477L3V

USD 820.00

6 Weeks

Lenti ORF particles, GTF2E2 (Myc-DDK tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone
RC203477L4

USD 620.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Tagged ORF Clone Lentiviral Particle
RC203477L4V

USD 820.00

6 Weeks

Lenti ORF particles, GTF2E2 (mGFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIE beta (GTF2E2) (NM_002095) Human Untagged Clone
SC118828

USD 310.00

In Stock

GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA313982

USD 345.00

In Stock

Rabbit polyclonal anti-TF2E2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TF2E2.
TFIIE beta (GTF2E2) (NM_002095) Human Over-expression Lysate
LY419544

USD 396.00

In Stock

Transient overexpression lysate of general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TFIIE beta (GTF2E2) (NM_002095) Human Untagged Clone
SC320510

USD 310.00

In Stock

GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
TFIIE beta (GTF2E2) (NM_002095) Human Over-expression Lysate
LC419544

USD 121.00

In Stock

GTF2E2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA329281

USD 375.00

5 Days

Rabbit Polyclonal anti-GTF2E2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA335216

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA335217

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the middle region of human GTF2E2. Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
GTF2E2 / TF2E2 (1-291, His-tag) Human Protein
AR50371PU-N

USD 1,105.00

2 Weeks

GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
GTF2E2 / TF2E2 (1-291, His-tag) Human Protein
AR50371PU-S

USD 415.00

2 Weeks

GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
TFIIE beta (GTF2E2) ICC Control Block
TB403477

USD 1,070.00

4 Weeks

Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TFIIE beta (GTF2E2) Cytosection
TS403477

USD 225.00

4 Weeks

Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TFIIE beta (GTF2E2) Cytosection
TS403477P5

USD 889.00

4 Weeks

Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack