GTF2E2 (Myc-DDK-tagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2E2 (Myc-DDK-tagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2E2 (GFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GTF2E2 (Myc-DDK tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GTF2E2 (mGFP-tagged) - Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-TF2E2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TF2E2. |
Transient overexpression lysate of general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GTF2E2 (untagged)-Human general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GTF2E2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal anti-GTF2E2 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG |
Rabbit Polyclonal Anti-GTF2E2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG |
Rabbit Polyclonal Anti-GTF2E2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the middle region of human GTF2E2. Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK |
GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
GTF2E2 / TF2E2 (1-291, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2E2 (NM_002095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack