Products

View as table Download

TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700026

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NFATC3

NFATC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFATC1

Mouse Monoclonal anti-NFATc1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit Polyclonal Anti-NFATC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE

NFATC2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human NFATC2

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the C terminal of human NFATC1. Synthetic peptide located within the following region: LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS

Rabbit Polyclonal NFAT4 (Ser165) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NFAT4 around the phosphorylation site of Serine 165
Modifications Phospho-specific

Rabbit monoclonal antibody against NFAT1 (clone EPR2973 )

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal NFAT3 (Ab-676) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T).

Rabbit Polyclonal NFAT4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NFAT4

Rabbit Polyclonal VAV1 Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human VAV1

Rabbit Polyclonal Anti-NFAT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of human NFAT5. Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN

Rabbit Polyclonal Anti-ZNF83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF83 antibody: synthetic peptide directed towards the N terminal of human ZNF83. Synthetic peptide located within the following region: MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the N terminal of human NFATC1. Synthetic peptide located within the following region: PSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSN
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.
TNF

USD 470.00

In Stock

Mouse Monoclonal Anti-TNF Antibody, Biotinylated

Applications E
Reactivities Human, Monkey
Conjugation Biotin

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit polyclonal VAV1 (Ab-174) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human VAV1 around the phosphorylation site of tyrosine 174 (E-I-Y-E-D).

Rabbit polyclonal Vav (Tyr174) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Vav around the phosphorylation site of tyrosine 174 (E-I-YP-E-D).
Modifications Phospho-specific

Rabbit polyclonal NFAT5/TonEBP (Ser155) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NFAT5/TonEBP around the phosphorylation site of serine 155 (D-N-SP-R-M).
Modifications Phospho-specific

Mouse Anti-Human TNF alpha Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal VAV1 (Tyr174) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human VAV1 around the phosphorylation site of Tyrosine 174
Modifications Phospho-specific

Rabbit Polyclonal TNFA Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TNFA

Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal antibody to VAV1 (vav 1 guanine nucleotide exchange factor)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 83 and 568 of VAV1 (Uniprot ID#P15498)

Rabbit polyclonal anti-Calcineurin A antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal NFATC4 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NFATC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 744-773 amino acids from the C-terminal region of human NFATC4.

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

Rabbit Polyclonal Anti-NFATC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the middle region of human NFATC4. Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV

Rabbit Polyclonal NFATC1/NFAT2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Amino acids 264-282 (NKRKYSLNGRQPPYSPHHS) of human NFATc1 were used as immunogen for this antibody.

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP

Applications ELISA
Reactivities Human
Conjugation HRP

Goat Anti-NFATC2 / NFAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QQFRTGLSSPDARYQ, from the internal region of the protein sequence according to NP_036472.2; NP_775114.1; NP_001129493.1.

Mouse Anti-Human TNF alpha Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

Anti-VAV1 (Phospho-Tyr174) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 174 (E-I-Y(p)-E-D) derived from Human Vav.
Modifications Phospho-specific

Anti-VAV1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa. 172~176 (E-I-Y-E-D) derived from Human Vav.

Biotinylated Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Biotinylated Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

NFATC3 / NFAT4 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (near N Terminus) (HQELDAHEDDLQIN)

Rabbit Polyclonal Anti-NFATC4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the N terminal of human NFATC4. Synthetic peptide located within the following region: RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSL

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the N terminal of human NFATC1. Synthetic peptide located within the following region: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASS

Rabbit Polyclonal Anti-NFATC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the N terminal of human NFATC4. Synthetic peptide located within the following region: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGE

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the N terminal of human NFATC1. Synthetic peptide located within the following region: PSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSN