Germany
Japan
United Kingdom
China
FOXP3 (Myc-DDK-tagged)-Human forkhead box P3 (FOXP3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
FOXP3 (GFP-tagged) - Human forkhead box P3 (FOXP3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FOXP3 (untagged)-Human forkhead box P3 (FOXP3), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310403 is the updated version of SC124018.
Lenti ORF particles, FOXP3 (Myc-DDK tagged) - Human forkhead box P3 (FOXP3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FOXP3 (mGFP-tagged) - Human forkhead box P3 (FOXP3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FOXP3 (Myc-DDK-tagged)-Human forkhead box P3 (FOXP3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Lenti ORF particles, FOXP3 (Myc-DDK tagged) - Human forkhead box P3 (FOXP3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FOXP3 (mGFP-tagged) - Human forkhead box P3 (FOXP3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of FOXP3 (Myc-DDK-tagged)-Human forkhead box P3 (FOXP3), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FOXP3 (Myc-DDK-tagged)-Human forkhead box P3 (FOXP3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of FOXP3 (mGFP-tagged)-Human forkhead box P3 (FOXP3), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FOXP3 (mGFP-tagged)-Human forkhead box P3 (FOXP3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FOXP3 (GFP-tagged) - Human forkhead box P3 (FOXP3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Purified recombinant protein of Human forkhead box P3 (FOXP3), transcript variant 2, (10ug), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human forkhead box P3 (FOXP3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human forkhead box P3 (FOXP3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human forkhead box P3 (FOXP3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
FOXP3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human forkhead box P3 (FOXP3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FOXP3 (untagged)-Human forkhead box P3 (FOXP3), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
FOXP3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-FOXP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL |
Mouse Monoclonal FOXP3 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against FOXP3
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human FOXP3 (between residues 1-50). |
Mouse Monoclonal FOXP3 Delta 2 (exon 2 deleted) specific Antibody (16J4G6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti FOXP3 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human FOXP3 protein. This sequence is identical within human, mouse, rat origins. |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI8H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI3H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI6B10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FOXP3 MS Standard C13 and N15-labeled recombinant protein (NP_054728)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-FOXP3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 410-424 amino acids of Human forkhead box P3 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- FOXP3
Families
- Transcription Factors