HMG20A (Myc-DDK-tagged)-Human high mobility group 20A (HMG20A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HMG20A (Myc-DDK-tagged)-Human high mobility group 20A (HMG20A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human high-mobility group 20A (HMG20A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human high mobility group 20A (HMG20A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HMG20A (Myc-DDK tagged) - Human high mobility group 20A (HMG20A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human high mobility group 20A (HMG20A), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HMG20A (mGFP-tagged) - Human high mobility group 20A (HMG20A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HMG20A (GFP-tagged) - Human high mobility group 20A (HMG20A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HMG20A (untagged)-Human high mobility group 20A (HMG20A)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the C terminal of human HMG20A. Synthetic peptide located within the following region: SMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR |
HMG20A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of high-mobility group 20A (HMG20A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Anti-HMG20A Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ATVREVVNRLDR, from the C Terminus of the protein sequence according to NP_060670.1. |
Rabbit Polyclonal anti-HMG20A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPE |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK |
Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HMG20A MS Standard C13 and N15-labeled recombinant protein (NP_060670)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMG20A mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMG20A mouse monoclonal antibody, clone OTI5E3 (formerly 5E3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HMG20A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of HMG20A (NM_018200) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HMG20A (NM_018200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HMG20A (NM_018200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack