Products

View as table Download

PPP2R1A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (PPP2R1A)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, PPP2R1A (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, PPP2R1A (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPP2R1A (GFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, PPP2R1A (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R1A (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPP2R1A (untagged)-Homo sapiens, clone MGC:786 IMAGE:2987938, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit anti-PPP2R1A Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A

PPP2R1A (untagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL

Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

PPP2R1A mouse monoclonal antibody, clone 4E6, Purified

Applications ELISA, IHC, WB
Reactivities Human

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PPP2R1A (untagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

PPP2R1A rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

PPP2R1A sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD

PPP2R1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Goat Anti-PP2A / PPP2R1A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KYFAQEALTVLSLA, from the C Terminus of the protein sequence according to NP_055040.2.

PPP2R1A MS Standard C13 and N15-labeled recombinant protein (NP_055040)

Tag C-Myc/DDK
Expression Host HEK293

PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R1A

USD 1,210.00

4 Weeks

Transient overexpression of PPP2R1A (NM_014225) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PPP2R1A (NM_014225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PPP2R1A (NM_014225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack