Products

cDNA Clones (21)
Antibodies (13)
Proteins (11)
Jump to Filters
View as table Download
SIRT6 (NM_016539) Human Tagged ORF Clone
RC202833

USD 420.00

In Stock

SIRT6 (Myc-DDK-tagged)-Human sirtuin 6 (SIRT6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SIRT6 (NM_016539) Human Tagged ORF Clone Lentiviral Particle
RC202833L1V

USD 820.00

3 Weeks

Lenti ORF particles, SIRT6 (Myc-DDK tagged) - Human sirtuin 6 (SIRT6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SIRT6 (NM_016539) Human Untagged Clone
SC123758

USD 310.00

In Stock

SIRT6 (untagged)-Human sirtuin 6 (SIRT6), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SIRT6 (NM_016539) Human Tagged ORF Clone
RG202833

USD 460.00

In Stock

SIRT6 (GFP-tagged) - Human sirtuin 6 (SIRT6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SIRT6 (NM_016539) Human Tagged ORF Clone
RC202833L3

USD 620.00

3 Weeks

Lenti ORF clone of Human sirtuin 6 (SIRT6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SIRT6 (NM_016539) Human Tagged ORF Clone Lentiviral Particle
RC202833L3V

USD 820.00

5 Weeks

Lenti ORF particles, SIRT6 (Myc-DDK tagged) - Human sirtuin 6 (SIRT6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SIRT6 (NM_016539) Human Tagged ORF Clone Lentiviral Particle
RC202833L4V

USD 820.00

3 Weeks

Lenti ORF particles, SIRT6 (mGFP-tagged) - Human sirtuin 6 (SIRT6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SIRT6 (NM_001193285) Human Tagged ORF Clone
RC230806

USD 420.00

3 Weeks

SIRT6 (Myc-DDK-tagged)-Human sirtuin 6 (SIRT6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SIRT6 (NM_001193285) Human Tagged ORF Clone
RC230806L3

USD 620.00

3 Weeks

Lenti-ORF clone of SIRT6 (Myc-DDK-tagged)-Human sirtuin 6 (SIRT6), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SIRT6 (NM_001193285) Human Tagged ORF Clone
RC230806L4

USD 620.00

3 Weeks

Lenti-ORF clone of SIRT6 (mGFP-tagged)-Human sirtuin 6 (SIRT6), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SIRT6 (NM_001193285) Human Tagged ORF Clone
RG230806

USD 460.00

3 Weeks

SIRT6 (GFP-tagged) - Human sirtuin 6 (SIRT6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SIRT6 (NM_016539) Human Tagged ORF Clone
RC202833L1

USD 768.00

In Stock

Lenti ORF clone of Human sirtuin 6 (SIRT6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SIRT6 (NM_016539) Human Tagged Lenti ORF Clone
RC202833L2

USD 768.00

In Stock

Lenti ORF clone of Human sirtuin 6 (SIRT6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SIRT6 (NM_001193285) Human Tagged ORF Clone
RC230806L2

USD 620.00

2 Weeks

Lenti-ORF clone of SIRT6 (mGFP-tagged)-Human sirtuin 6 (SIRT6), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SIRT6 Mouse Monoclonal Antibody [Clone ID: 1B5-G10-H9]
TA347046

USD 380.00

4 Weeks

Mouse Monoclonal SIRT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
SIRT6 (NM_016539) Human Over-expression Lysate
LY402563

USD 396.00

5 Days

Transient overexpression lysate of sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) (SIRT6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SIRT6 (NM_001193285) Human Tagged ORF Clone
RC230806L1

USD 620.00

3 Weeks

Lenti-ORF clone of SIRT6 (Myc-DDK-tagged)-Human sirtuin 6 (SIRT6), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SIRT6 Rabbit Polyclonal Antibody
TA336289

USD 430.00

5 Days

Rabbit Polyclonal SIRT6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the mouse SIRT6 protein (within residues 250-334). [Swiss-Prot P59941]
SIRT6 (NM_016539) Human Over-expression Lysate
LC402563

USD 121.00

In Stock

SIRT6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SIRT6 Rabbit Polyclonal Antibody
TA301524

USD 424.00

5 Days

Rabbit Polyclonal Antibody against SIRT6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human SIRT6 protein (within residues 300-355). [Swiss-Prot Q8N6T7]
SIRT6 Rabbit Polyclonal Antibody
TA301523

USD 424.00

5 Days

Rabbit Polyclonal Antibody against SIRT6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human SIRT6 protein (within residues 250-350). [Swiss-Prot Q8N6T7]
SIRT6 Chicken Polyclonal Antibody
TA319931

USD 430.00

5 Days

Chicken Polyclonal SIRT6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIRT6 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SIRT6.
SIRT6 Rabbit Polyclonal Antibody
TA330290

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the middle region of human SIRT6. Synthetic peptide located within the following region: TRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVP
SIRT6 Rabbit Polyclonal Antibody
TA330291

USD 310.00

5 Days

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6. Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG
SIRT6 (1-355, His-tag) Human Protein
AR09083PU-L

USD 1,620.00

2 Weeks

SIRT6 (1-355, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
SIRT6 (1-355, His-tag) Human Protein
AR09083PU-N

USD 590.00

2 Weeks

SIRT6 (1-355, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
SIRT6 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF503670

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SIRT6 (NM_016539) Human Mass Spec Standard
PH302833

USD 2,055.00

3 Weeks

SIRT6 MS Standard C13 and N15-labeled recombinant protein (NP_057623)

Tag C-Myc/DDK
Expression Host HEK293
SIRT6 (NM_016539) Human Tagged ORF Clone Lentiviral Particle
RC202833L2V

USD 820.00

3 Weeks

Lenti ORF particles, SIRT6 (mGFP-tagged) - Human sirtuin 6 (SIRT6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SIRT6 Rabbit Polyclonal Antibody
TA324068

USD 345.00

In Stock

Anti-SIRT6 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 35-274 amino acids of human sirtuin 6
SIRT6 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
TA503670

USD 379.00

In Stock

SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SIRT6 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
TA503670S

USD 159.00

In Stock

SIRT6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SIRT6 (NM_016539) ICC Control Block
TB402833

USD 1,070.00

4 Weeks

Transient overexpression of SIRT6 (NM_016539) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SIRT6 (NM_001193285) ICC Control Block
TB430806

USD 1,070.00

4 Weeks

Transient overexpression of SIRT6 (NM_001193285) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SIRT6 Cytosection
TS402833

USD 225.00

4 Weeks

Transient overexpression of SIRT6 (NM_016539) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SIRT6 Cytosection
TS402833P5

USD 889.00

4 Weeks

Transient overexpression of SIRT6 (NM_016539) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SIRT6 ICC Control Sections
TS430806P5

USD 889.00

4 Weeks

Transient overexpression of SIRT6 (NM_001193285) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack