VDR (Myc-DDK-tagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VDR (Myc-DDK-tagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
VDR (Myc-DDK-tagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
VDR (Myc-DDK tagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
VDR (GFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
VDR (GFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
VDR (GFP-tagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
VDR (untagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Vitamin D Receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
VDR (untagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Vitamin D Receptor (VDR) mouse monoclonal antibody, clone 2F4
Applications | ELISA, IHC |
Reactivities | Human |
Vitamin D Receptor (VDR) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
VDR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Vitamin D Receptor (Ser208) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor around the phosphorylation site of Serine 208 |
Modifications | Phospho-specific |
Rabbit polyclonal Vitamin D3 Receptor (Phospho-Ser51) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K). |
Modifications | Phospho-specific |
Rabbit polyclonal Vitamin D3 Receptor (Ab-51) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K). |
Vitamin D Receptor (VDR) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal Vitamin D Receptor (Ser208) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D Receptor around the phosphorylation site of serine 208 (D-L-SP-E-E). |
Modifications | Phospho-specific |
Vitamin D Receptor (VDR) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 273-299 amino acids from the Central region of human VDR |
Goat Polyclonal Antibody against VDR
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CGNQDYKYRVSD, from the internal region of the protein sequence according to NP_000367.1; NP_001017535.1. |
Rabbit Polyclonal anti-VDR antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: LKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPV |
Rabbit Polyclonal Anti-VDR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS |
Rabbit Polyclonal Anti-VDR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP |
VDR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VDR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VDR MS Standard C13 and N15-labeled recombinant protein (NP_000367)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
VDR MS Standard C13 and N15-labeled recombinant protein (NP_001017535)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
VDR (untagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of VDR (NM_000376) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDR (NM_001017535) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDR (NM_001017536) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDR (NM_000376) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack