Germany
Japan
United Kingdom
China
VDR (Myc-DDK-tagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
VDR (Myc-DDK-tagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
VDR (Myc-DDK tagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
VDR (GFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VDR (GFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VDR (GFP-tagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VDR (untagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
5 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, VDR (Myc-DDK tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, VDR (mGFP-tagged) - Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Vitamin D Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor |
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
VDR (untagged)-Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
VDR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Vitamin D Receptor (Ser208) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor around the phosphorylation site of Serine 208 |
| Modifications | Phospho-specific |
Rabbit polyclonal Vitamin D3 Receptor (Phospho-Ser51) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Vitamin D3 Receptor (Ab-51) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Vitamin D3 Receptor around the phosphorylation site of serine 51 (R-R-SP-M-K). |
Rabbit polyclonal Vitamin D Receptor (Ser208) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Vitamin D Receptor around the phosphorylation site of serine 208 (D-L-SP-E-E). |
| Modifications | Phospho-specific |
Vitamin D Receptor (VDR) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 273-299 amino acids from the Central region of human VDR |
Goat Polyclonal Antibody against VDR
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CGNQDYKYRVSD, from the internal region of the protein sequence according to NP_000367.1; NP_001017535.1. |
Rabbit Polyclonal anti-VDR antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: LKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPV |
Rabbit Polyclonal Anti-VDR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS |
Rabbit Polyclonal Anti-VDR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP |
VDR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
VDR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
LY422745 is the same product as LY425408.
VDR MS Standard C13 and N15-labeled recombinant protein (NP_000367)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
VDR MS Standard C13 and N15-labeled recombinant protein (NP_001017535)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
VDR (untagged) - Homo sapiens vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of VDR (NM_000376) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDR (NM_001017535) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDR (NM_001017536) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VDR (NM_000376) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- VDR
Families
- Transcription Factors