PDE3B (Myc-DDK-tagged)-Human phosphodiesterase 3B, cGMP-inhibited (PDE3B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE3B (Myc-DDK-tagged)-Human phosphodiesterase 3B, cGMP-inhibited (PDE3B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
G6PC (Myc-DDK-tagged)-Human glucose-6-phosphatase, catalytic subunit (G6PC)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
G6PC2 (Myc-DDK-tagged)-Human glucose-6-phosphatase, catalytic, 2 (G6PC2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC2A4 (Myc-DDK-tagged)-Human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PTPN1 (Myc-DDK-tagged)-Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
INSR (Myc-DDK-tagged)-Human insulin receptor (INSR), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDE3A (Myc-DDK-tagged)-Human phosphodiesterase 3A, cGMP-inhibited (PDE3A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP1R3A (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 3A (PPP1R3A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC2A4 (GFP-tagged) - Human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
INSR (Myc-DDK-tagged)-Human insulin receptor (INSR), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
INSR (GFP-tagged) - Human insulin receptor (INSR), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PTPN1 (untagged)-Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
INSR (GFP-tagged) - Human insulin receptor (INSR), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 460.00
In Stock
G6PC (GFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PTPN1 (Myc-DDK tagged) - Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PTPN1 (mGFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, G6PC2 (Myc-DDK tagged) - Human glucose-6-phosphatase, catalytic, 2 (G6PC2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, G6PC2 (mGFP-tagged) - Human glucose-6-phosphatase, catalytic, 2 (G6PC2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 870.00
3 Weeks
Lenti ORF particles, SLC2A4 (Myc-DDK tagged) - Human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 870.00
6 Weeks
Lenti ORF particles, SLC2A4 (mGFP-tagged) - Human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PPP1R3A (Myc-DDK tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 3A (PPP1R3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PPP1R3A (mGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 3A (PPP1R3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,000.00
3 Weeks
Lenti ORF particles, INSR (Myc-DDK-tagged)-Human insulin receptor (INSR), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,000.00
6 Weeks
Lenti ORF particles, INSR (mGFP-tagged)-Human insulin receptor (INSR), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ACACB (Myc-DDK-tagged)-Human acetyl-CoA carboxylase beta (ACACB)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ACACB (Myc-DDK tagged) - Human acetyl-CoA carboxylase beta (ACACB), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, G6PC (Myc-DDK tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, G6PC (mGFP-tagged) - Human glucose-6-phosphatase, catalytic subunit (G6PC), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PDE3B (Myc-DDK tagged) - Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PDE3B (mGFP-tagged) - Human phosphodiesterase 3B, cGMP-inhibited (PDE3B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PDE3A (Myc-DDK tagged) - Human phosphodiesterase 3A, cGMP-inhibited (PDE3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PDE3A (mGFP-tagged) - Human phosphodiesterase 3A, cGMP-inhibited (PDE3A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PTPRF (Myc-DDK tagged) - Human protein tyrosine phosphatase, receptor type, F (PTPRF), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
PTPRF (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, F (PTPRF), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PTPN1 (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human protein tyrosine phosphatase, non-receptor type 1 (PTPN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
INSR (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens insulin receptor, transcript variant 1, Signal peptide (1-27) plus EC domain (763-956)
Vector | pCMV6-XL5-DDK-His |
Tag | DDK-His |
Mammalian Cell Selection | None |
G6PC2 (GFP-tagged) - Human glucose-6-phosphatase, catalytic, 2 (G6PC2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP1R3A (GFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 3A (PPP1R3A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDE3A (GFP-tagged) - Human phosphodiesterase 3A, cGMP-inhibited (PDE3A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SLC2A4 (untagged)-Human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
INSR (untagged)-Human insulin receptor (INSR), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PTPN1 (Myc-DDK tagged) - Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PTPN1 (mGFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PTPRF (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, F (PTPRF), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glucose-6-phosphatase, catalytic, 2 (G6PC2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, G6PC2 (Myc-DDK tagged) - Human glucose-6-phosphatase, catalytic, 2 (G6PC2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |