Products

cDNA Clones (18)
Proteins (7)
Antibodies (5)
Jump to Filters
View as table Download
Claudin18 (CLDN18) (NM_016369) Human Tagged ORF Clone
RC212135

USD 98.00

USD 390.00

In Stock

CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin18 (CLDN18) (NM_001002026) Human Tagged ORF Clone
RC219760

USD 420.00

In Stock

CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin18 (CLDN18) (NM_016369) Human Tagged ORF Clone
RG212135

USD 460.00

In Stock

CLDN18 (GFP-tagged) - Human claudin 18 (CLDN18), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin18 (CLDN18) (NM_001002026) Human Tagged ORF Clone
RG219760

USD 460.00

In Stock

CLDN18 (GFP-tagged) - Human claudin 18 (CLDN18), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin18 (CLDN18) (NM_016369) Human Tagged ORF Clone
RC212135L3

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin18 (CLDN18) (NM_016369) Human Tagged ORF Clone
RC212135L2

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN18 (mGFP-tagged)-Human claudin 18 (CLDN18), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Claudin18 (CLDN18) (NM_001002026) Human Untagged Clone
SC300395

USD 540.00

In Stock

CLDN18 (untagged)-Human claudin 18 (CLDN18), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Claudin18 (CLDN18) (NM_016369) Human Untagged Clone
SC126873

USD 540.00

In Stock

CLDN18 (untagged)-Human claudin 18 (CLDN18), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Claudin18 (CLDN18) Rabbit Polyclonal Antibody
TA346055

USD 475.00

5 Days

Rabbit Polyclonal Anti-CLDN18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM
Claudin18 (CLDN18) Rabbit Polyclonal Antibody
TA346056

USD 475.00

5 Days

Rabbit Polyclonal Anti-CLDN18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE
Claudin18 (CLDN18) (NM_016369) Human Tagged ORF Clone
RC212135L1

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Claudin18 (CLDN18) (NM_001002026) Human Tagged ORF Clone
RC219760L1

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Claudin18 (CLDN18) (NM_001002026) Human Tagged ORF Clone
RC219760L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Claudin18 (CLDN18) Rabbit Polyclonal Antibody
TA333778

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDN18 Antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY
Claudin18 (CLDN18) (NM_016369) ICC Control Block
TB412135

USD 1,040.00

4 Weeks

Transient overexpression of CLDN18 (NM_016369) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin18 (CLDN18) (NM_001002026) ICC Control Block
TB419760

USD 1,070.00

4 Weeks

Transient overexpression of CLDN18 (NM_001002026) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin18 (CLDN18) (NM_001002026) Human Recombinant Protein
TP762673

USD 261.00

2 Weeks

Purified recombinant protein of Human claudin 18 (CLDN18), transcript variant 2, 28Asp-78Ala-GGGGS-145Thr-167Thr, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Claudin18 (CLDN18) Cytosection
TS412135

USD 225.00

4 Weeks

Transient overexpression of CLDN18 (NM_016369) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin18 (CLDN18) Cytosection
TS412135P5

USD 889.00

4 Weeks

Transient overexpression of CLDN18 (NM_016369) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin18 (CLDN18) Cytosection
TS419760

USD 225.00

4 Weeks

Transient overexpression of CLDN18 (NM_001002026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin18 (CLDN18) Cytosection
TS419760P5

USD 889.00

4 Weeks

Transient overexpression of CLDN18 (NM_001002026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack