Products

Antibodies (16)
cDNA Clones (11)
Proteins (8)
Jump to Filters
View as table Download
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RC206056

USD 98.00

USD 390.00

In Stock

NPY (Myc-DDK-tagged)-Human neuropeptide Y (NPY)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RG206056

USD 460.00

In Stock

NPY (GFP-tagged) - Human neuropeptide Y (NPY)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Neuropeptide Y (NPY) (68-97) Rabbit Polyclonal Antibody
AP09564SU-N

USD 600.00

2 Weeks

Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic Prepro-NPY 68-97 (C-PON).
Neuropeptide Y (NPY) (NM_000905) Human Untagged Clone
SC119601

USD 310.00

In Stock

NPY (untagged)-Human neuropeptide Y (NPY)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA346234

USD 475.00

5 Days

Rabbit Polyclonal Anti-NPY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP
Neuropeptide Y (NPY) (NM_000905) Human Recombinant Protein
TP761100

USD 215.00

In Stock

Purified recombinant protein of Human neuropeptide Y (NPY), full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
Neuropeptide Y (NPY) (31-36) Rabbit Polyclonal Antibody
AP22875PU-N

USD 440.00

2 Weeks

Neuropeptide Y (NPY) (31-36) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Porcine
Immunogen Synthetic Porcine Neuropeptide Y coupled to bovine thyroglobulin via glutaraldehyde
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RC206056L1

USD 620.00

In Stock

Lenti ORF clone of Human neuropeptide Y (NPY), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Neuropeptide Y (NPY) (NM_000905) Human Tagged ORF Clone
RC206056L2

USD 620.00

3 Weeks

Lenti ORF clone of Human neuropeptide Y (NPY), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
BP162

USD 340.00

5 Days

Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic peptide corresponding to the C-flanking peptide (amino acids 68-97) of Neuropeptide Y.
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
RA24603-100

USD 360.00

2 Weeks

Neuropeptide Y (NPY) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
AP20664PU-N

USD 370.00

2 Weeks

Neuropeptide Y (NPY) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Neuropeptide Y (NPY) Guinea Pig Polyclonal Antibody
GP14107-150

USD 440.00

2 Weeks

Neuropeptide Y (NPY) guinea pig polyclonal antibody

Applications IHC
Reactivities Rat
Conjugation Unconjugated
Neuropeptide Y / NPY Human Protein
AR05070PU-N

USD 270.00

5 Days

Neuropeptide Y / NPY human protein, 0.1 mg

Neuropeptide Y / NPY Human, Rat Protein
AR31131PU-L

USD 540.00

5 Days

Neuropeptide Y / NPY human, rat protein, 1.0 mg

Neuropeptide Y / NPY Human, Rat Protein
AR31131PU-N

USD 365.00

5 Days

Neuropeptide Y / NPY human, rat protein, 0.5 mg

Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]
CF808282

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Neuropeptide Y (NPY) Rabbit Polyclonal Antibody
TA321231

USD 345.00

In Stock

Anti-NPY Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]
TA808282

USD 379.00

In Stock

NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]
TA808282S

USD 159.00

2 Days

NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Neuropeptide Y (NPY) ICC Control Block
TB406056

USD 1,040.00

4 Weeks

Transient overexpression of NPY (NM_000905) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Neuropeptide Y (NPY) (NM_000905) Human Recombinant Protein
TP306056

USD 867.00

2 Weeks

Purified recombinant protein of Human neuropeptide Y (NPY), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Tag Myc-DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Neuropeptide Y (NPY) Cytosection
TS406056

USD 225.00

4 Weeks

Transient overexpression of NPY (NM_000905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Neuropeptide Y (NPY) Cytosection
TS406056P5

USD 889.00

4 Weeks

Transient overexpression of NPY (NM_000905) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack