Products

Antibodies (52)

cDNA Clones (13)

Proteins (12)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 77 results

Page 1 of 2

(reset)

Melanoma gp100 (PMEL) (NM_006928) Human Tagged ORF Clone

RC200663

USD 98.00

USD 560.00

In Stock

PMEL (Myc-DDK-tagged)-Human premelanosome protein (PMEL), transcript variant 3

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) (NM_006928) Human Untagged Clone

SC122763

USD 310.00

In Stock

PMEL (untagged)-Human premelanosome protein (PMEL), transcript variant 3

Vector	pCMV6-XL5
Tag	Tag Free
Mammalian Cell Selection	None

Melanoma gp100 (PMEL) (NM_006928) Human Recombinant Protein

TP300663

USD 823.00

In Stock

Recombinant protein of human silver homolog (mouse) (SILV)

Tag	C-Myc/DDK
Expression Host	HEK293T

• 

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Melanoma gp100 (PMEL) (NM_006928) Human Tagged ORF Clone Lentiviral Particle

RC200663L1V

USD 820.00

3 Weeks

Lenti ORF particles, PMEL (Myc-DDK tagged) - Human premelanosome protein (PMEL), transcript variant 3, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

Melanoma gp100 (PMEL) (NM_006928) Human Tagged ORF Clone

RG200663

USD 460.00

In Stock

PMEL (GFP-tagged) - Human premelanosome protein (PMEL), transcript variant 3

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

Melanoma gp100 (PMEL) (NM_001200054) Human Tagged ORF Clone

RC234681

USD 610.00

In Stock

PMEL (Myc-DDK tagged) - Homo sapiens premelanosome protein (PMEL), transcript variant 1

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

Melanoma gp100 (PMEL) (NM_001200054) Human Tagged ORF Clone

RG234681

USD 670.00

In Stock

PMEL (GFP-tagged) - Homo sapiens premelanosome protein (PMEL), transcript variant 1

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

Melanoma gp100 (PMEL) (NM_006928) Human Tagged ORF Clone Lentiviral Particle

RC200663L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, PMEL (Myc-DDK tagged) - Human premelanosome protein (PMEL), transcript variant 3, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

Melanoma gp100 (PMEL) (NM_001200053) Human Tagged ORF Clone

RC234469

USD 480.00

5 Weeks

PMEL (Myc-DDK tagged) - Homo sapiens premelanosome protein (PMEL), transcript variant 2

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

Melanoma gp100 (PMEL) (NM_001200053) Human Tagged ORF Clone

RG234469

USD 530.00

5 Weeks

PMEL (GFP-tagged) - Homo sapiens premelanosome protein (PMEL), transcript variant 2

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

Melanoma gp100 (PMEL) (NM_006928) Human Over-expression Lysate

LY402062

USD 396.00

In Stock

Transient overexpression lysate of silver homolog (mouse) (SILV)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Melanoma gp100 (PMEL) (NM_006928) Human Tagged ORF Clone Lentiviral Particle

RC200663L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, PMEL (mGFP-tagged) - Human premelanosome protein (PMEL), transcript variant 3, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

Melanoma gp100 (PMEL) (NM_006928) Human Tagged ORF Clone Lentiviral Particle

RC200663L2V

USD 1,020.00

3 Weeks

Lenti ORF particles, PMEL (mGFP-tagged) - Human premelanosome protein (PMEL), transcript variant 3, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®
• 

Melanoma gp100 (PMEL) Goat Polyclonal Antibody

TA302608

USD 375.00

In Stock

Goat Polyclonal Antibody against Silver homologue / Pmel 17

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence CPIGENSPLLSGQQ, from the C Terminus of the protein sequence according to NP_008859.1.

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) (NM_006928) Human Over-expression Lysate

LC402062

USD 121.00

In Stock

PMEL HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Melanoma gp100 (PMEL) Rabbit Polyclonal Antibody

TA341871

USD 310.00

5 Days

Rabbit Polyclonal Anti-SILV Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI9G3]

CF500400

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI8A4]

CF500402

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI7B2]

CF500423

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI7B2 (formerly 7B2)

Applications	FC, IF
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI10E5]

CF500424

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI7E3]

CF500425

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications	FC, IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI1E5]

CF803054

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI6D5]

CF803133

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI4D12]

CF803177

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) PMEL mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI3G5]

CF803485

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI4H4]

CF803486

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI4H4 (formerly 4H4)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated

• 

Melanoma gp100 (PMEL) (NM_006928) Human Mass Spec Standard

PH300663

USD 2,055.00

3 Weeks

SILV MS Standard C13 and N15-labeled recombinant protein (NP_008859)

Tag	C-Myc/DDK
Expression Host	HEK293

Melanoma gp100 (PMEL) (NM_001200053) Human Untagged Clone

SC331403

USD 590.00

5 Weeks

PMEL (untagged) - Homo sapiens premelanosome protein (PMEL), transcript variant 2

Vector	pCMV6 series
Tag	Tag Free

Melanoma gp100 (PMEL) (NM_001200054) Human Untagged Clone

SC331404

USD 680.00

5 Weeks

PMEL (untagged) - Homo sapiens premelanosome protein (PMEL), transcript variant 1

Vector	pCMV6 series
Tag	Tag Free

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI9G3]

TA500400

USD 379.00

In Stock

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G3]

TA500400AM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9G3]

TA500400BM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI9G3]

TA500400S

USD 159.00

2 Days

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications	IF, IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI8A4]

TA500402

USD 379.00

In Stock

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A4]

TA500402AM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A4]

TA500402BM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI8A4]

TA500402S

USD 159.00

2 Days

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI7B2]

TA500423

USD 379.00

In Stock

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7B2 (formerly 7B2)

Applications	FC, IF
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B2]

TA500423AM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7B2 (formerly 7B2), Biotinylated

Applications	FC, IF
Reactivities	Human
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B2]

TA500423BM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7B2 (formerly 7B2), HRP conjugated

Applications	FC, IF
Reactivities	Human
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI7B2]

TA500423S

USD 159.00

2 Days

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7B2 (formerly 7B2)

Applications	FC, IF
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI10E5]

TA500424

USD 379.00

In Stock

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10E5]

TA500424AM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Biotin

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10E5]

TA500424BM

USD 420.00

4 Weeks

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	HRP

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI10E5]

TA500424S

USD 159.00

In Stock

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI7E3]

TA500425

USD 379.00

In Stock

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications	FC, IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E3]

TA500425AM

USD 420.00

4 Weeks

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3), Biotinylated

Applications	FC, IHC
Reactivities	Human
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E3]

TA500425BM

USD 420.00

4 Weeks

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3), HRP conjugated

Applications	FC, IHC
Reactivities	Human
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI7E3]

TA500425S

USD 159.00

In Stock

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications	FC, IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: OTI1E5]

TA803054

USD 379.00

In Stock

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

1 - 50 of 77 results

Page 1 of 2