Germany
Japan
United Kingdom
China
Rabbit anti-PSME2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME2 |
Products
View as table Download
Rabbit Polyclonal Anti-CALR Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALR antibody: synthetic peptide directed towards the middle region of human CALR. Synthetic peptide located within the following region: ASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWE |
beta 2 Microglobulin (B2M) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Human b2-Microglobulin. |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein. |
Rabbit polyclonal anti-RFX5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit Polyclonal CREB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB around the phosphorylation site of Serine 133 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CREB (Ser142) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB around the phosphorylation site of Serine 142 |
| Modifications | Phospho-specific |
PSME3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME3 |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
KLRD1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KLRD1 |
Rabbit Polyclonal Anti-NFYC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFYC antibody is: synthetic peptide directed towards the N-terminal region of Human NFYC. Synthetic peptide located within the following region: EGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMK |
Rabbit Polyclonal Anti-PSME1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME1 antibody: synthetic peptide directed towards the middle region of human PSME1. Synthetic peptide located within the following region: KEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEI |
Rabbit Polyclonal Anti-CALR Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALR antibody: synthetic peptide directed towards the middle region of human CALR. Synthetic peptide located within the following region: PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT |
Rabbit Polyclonal Anti-CALR Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CALR antibody is: synthetic peptide directed towards the N-terminal region of Human CALR. Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ |
Rabbit Polyclonal Anti-KIR2DL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIR2DL4 antibody: synthetic peptide directed towards the middle region of human KIR2DL4. Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-KIR3DL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIR3DL1 antibody is: synthetic peptide directed towards the middle region of Human KIR3DL1. Synthetic peptide located within the following region: EHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVT |
Rabbit Polyclonal Anti-GRP78 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRP78 Antibody: A synthesized peptide derived from human GRP78 |
Rabbit Polyclonal Anti-HSP90A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSP90A Antibody: A synthesized peptide derived from human HSP90A |
Rabbit Polyclonal Anti-CD8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
Rabbit Polyclonal Anti-HSP90B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSP90B Antibody: A synthesized peptide derived from human HSP90B |
Rabbit Polyclonal Anti-Phospho-HSP90B (Ser254) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-HSP90B (Ser254) Antibody: A synthesized peptide derived from human HSP90B around the phosphorylation site of Serine 254 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CD4 Antibody: Peptide with sequence C-KNKEVSVKRVTQDPK, from the internal region of the protein sequence according to NP_000607.1; NP_001181943.1. |
Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Goat Polyclonal Antibody against PSME2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2. |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CREB (Ab-100) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CREB around the phosphorylation site of threonine 100 (S-G-TP-Q-I). |
Rabbit polyclonal CREB (Thr100) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of threonine 100 (S-G-TP-Q-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL1. |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HA2Q antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CIITA. |
Rabbit polyclonal anti-NFYA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFYA. |
Rabbit polyclonal Hsp 90 alpha antibody
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 289-300 of human Hsp90 protein. |
Active filters
Isotypes
- IgG
Pathways
- Antigen processing and presentation
Filter by
Category
Target Symbol
- CREB1 (22)
- HSP90AB1 (12)
- CALR (10)
- CANX (8)
- HSP90AA1 (8)
- HSPA1A (8)
- PDIA3 (7)
- B2M (6)
- CD8A (6)
- CD4 (5)
- HSPA8 (5)
- KIR2DL3 (5)
- NFYA (5)
- CD74 (4)
- CD8B (4)
- CIITA (4)
- CTSL (4)
- HSPA5 (4)
- KIR3DL1 (4)
- KLRC1 (4)
- NFYB (4)
- NFYC (4)
- PSME2 (4)
- PSME3 (4)
- TAP2 (4)
- CTSB (3)
- HSPA4 (3)
- LGMN (3)
- PSME1 (3)
- RFX5 (3)
- CTSS (2)
- HLA-A (2)
- HLA-DMA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DQA2 (2)
- HLA-DRA (2)
- HLA-DRB3 (2)
- HLA-F (2)
- HSPA1L (2)
- HSPA6 (2)
- IFI30 (2)
- IFNA16 (2)
- IFNA2 (2)
- IFNA4 (2)
- LTA (2)
- RFXAP (2)
- SMURF2 (2)
- HLA-B (1)
- HLA-DMB (1)
- HLA-DOA (1)
- HLA-DPB1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- HLA-G (1)
- HSPA2 (1)
- IFNA13 (1)
- IFNA5 (1)
- IFNA6 (1)
- IFNA7 (1)
- IFNA8 (1)
- KIR2DL1 (1)
- KIR2DL4 (1)
- KIR2DL5A (1)
- KIR3DL2 (1)
- KLRC4 (1)
- KLRD1 (1)
- TAP1 (1)
- TAPBP (1)