Rabbit polyclonal DMRTA2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | This DMRTA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 487-515 amino acids from the C-terminal region of human DMRTA2. |
Rabbit polyclonal AGR2 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AGR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 95-124 amino acids from the Central region of human AGR2. |
Rabbit Polyclonal anti-FOSL2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
Rabbit Polyclonal Anti-NOLC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Mouse Monoclonal Anti-alpha-Tubulin Antibody [2B11]
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-MGP Antibody
| Applications | WB |
| Reactivities | Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 26 aa to the C-terminus of zebra fish MGP produced in E. coli. |
Rabbit Polyclonal Antibody against MAT1/2 alpha
| Applications | WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Orang-Utan, Monkey (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human MAT2A protein (within residues 100-200). [Swiss-Prot# P31153] |
Goat Polyclonal Antibody against ELMO1
| Applications | WB |
| Reactivities | Human, Cow, ZebraFish |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PKEPSNYDFVYDCN, from the C Terminus of the protein sequence according to NP_055615.8; NP_569709.1; NP_001034548.1. |
Goat Polyclonal Antibody against HSP90B1
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KEGVKFDESEKTKE, from the internal region of the protein sequence according to NP_003290.1. |
Goat Polyclonal Antibody against FOXP2 (Internal region)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEVEYQKRRSQKIT, from the internal region of the protein sequence according to NP_055306.1; NP_683696.1; NP_683697.1; NP_683698.1. |
Goat Polyclonal Antibody against PTF1A
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-WTDEKQLKEQN, from the internal region of the protein sequence according to NP_835455.1. |
Rabbit polyclonal antibody to Lipoic acid synthetase (lipoic acid synthetase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 54 and 258 of Lipoic acid synthetase (Uniprot ID#O43766) |
Rabbit polyclonal antibody to FAM50A (family with sequence similarity 50, member A)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 149 and 339 of FAM50A (Uniprot ID#Q14320) |
Rabbit polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 533 and 792 of SART1 (Uniprot ID#O43290) |
Rabbit polyclonal antibody to VPAC2 (vasoactive intestinal peptide receptor 2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 334 and 423 of VPAC2 |
Rabbit polyclonal antibody to Axin 1 (axin 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 800 and 862 of AXIN1 (Uniprot ID#O15169) |
Rabbit polyclonal antibody to Thymidylate synthetase (thymidylate synthetase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 313 of Thymidylate synthetase (Uniprot ID#P04818) |
Rabbit polyclonal antibody to C11orf2 (chromosome 11 open reading frame2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 489 and 721 of C11orf2 (Uniprot ID#Q9UID3) |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (94%). |
SURF4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Xenopus, Gorilla, Human, Mouse, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | SURF4 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Turkey, Chicken, Xenopus, Salmon (100%); Marmoset, Hamster, Elephant, Panda, Dog, Bat, Opossum, Platypus, Pufferfish, Zebrafish (94%); Stickleback (89%). |
GPR4 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | GPR4 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human GPR4. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Dog, Panda, Pig (100%); Bovine, Bat, Rabbit, Zebrafish (95%); Mouse, Rat (85%). |
Rabbit polyclonal anti-MECT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Zebrafish, Pufferfish, Bovine |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-34 of human MECT1 protein. |
Rabbit polyclonal ECT2 phospho T790 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Chimpanzee, Chicken, Human, Mouse, Rat, Zebrafish, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 785-795 of human ECT2 protein. |
| Modifications | Phospho-specific |
Rabbit polyclonal FAM50A Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FAM50A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 311-339 amino acids from the C-terminal region of human FAM50A. |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7]
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
AKT1 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKT1 |
| Modifications | Unmodified |
CRYAA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human CRYAA (NP_000385.1). |
| Modifications | Unmodified |
NSF Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NSF (NP_006169.2). |
| Modifications | Unmodified |
RPLP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human RPLP1 (NP_000994.1). |
| Modifications | Unmodified |
TDP 43 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human TDP43 |
Anti-RBPMS Antibody
| Applications | FC, ICC, IHC, WB |
| Reactivities | Feline, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Pig, Whale, Tree Shrew |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region of rat RBPMS, conjugated to keyhole limpet hemocyanin (KLH). |
Germany
Japan
United Kingdom
China
