Germany
Japan
United Kingdom
China
PQBP1 (GFP-tagged) - Human polyglutamine binding protein 1 (PQBP1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadPQBP1 (GFP-tagged) - Human polyglutamine binding protein 1 (PQBP1), transcript variant 10
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PQBP1 (GFP-tagged) - Human polyglutamine binding protein 1 (PQBP1), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PQBP1 (GFP-tagged) - Human polyglutamine binding protein 1 (PQBP1), transcript variant 9
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PQBP1 (GFP-tagged) - Human polyglutamine binding protein 1 (PQBP1), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal anti-PQBP1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: PSCGLPYYWNADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPS |
Rabbit Polyclonal Anti-PQBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: LVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSH |
PQBP1 (1-265, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PQBP1 (1-265, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY422317 is the same product as LY425530.
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY422318 is the same product as LY425531.
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY422319 is the same product as LY425532.
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY422320 is the same product as LY425533.
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 10
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027553)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027556)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027554)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1) transcript variant 10
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1) transcript variant 7
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1) transcript variant 9
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PQBP1 (untagged)-Human polyglutamine binding protein 1 (PQBP1) transcript variant 8
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of PQBP1 (NM_001032381) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PQBP1 (NM_001032384) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PQBP1 (NM_005710) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PQBP1 (NM_001032382) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PQBP1 (NM_001032383) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PQBP1 (NM_001167992) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- PQBP1
Pathways
- Spliceosome