Germany
Japan
United Kingdom
China
Lenti ORF clone of Human clusterin (CLU), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Products
View as table DownloadLenti ORF clone of Human clusterin (CLU), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of CLU (mGFP-tagged)-Human clusterin (CLU), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CLU (untagged)-Human clusterin (CLU) transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Anti-Clusterin / ApoJ (mouse) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKALQEYRRKSRAE, from the C Terminus of the protein sequence according to NP_038520.1. |
Clu - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
qSTAR qPCR primer pairs against Homo sapiens gene CLU
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
CLU HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CLU (untagged)-Human clusterin (CLU), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CLU - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Mouse Clusterin ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse Clusterin |
| Reactivities | Mouse |
qSTAR qPCR primer pairs against Mus musculus gene Clu
CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of clusterin (CLU) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Anti-CLU Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 230 amino acids of human clusterin |
Rabbit Polyclonal Anti-CLU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN |
Clu - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Apolipoprotein J / Apo J (23-449, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Apolipoprotein J / Apo J (23-449, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Human Clusterin ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human Clusterin |
| Reactivities | Human |
For Quantitative Detection of rat Clusterin in cell culture supernates, serum and plasma (heparin, EDTA).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Rat Clu |
| Format | 8x12 divisible strips |
| Reactivities | Rat |
The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detect Human Clusterin/CLU with <20pg/ml sensitivity. Format: 96-well plate with removable strips. Compatible samples: cell culture supernates, serum, plasma(heparin, EDTA), saliva and urine. This is a TMB colorimetric sandwich ELISA kit with short assay time and fast experiment set up. Clusterin/CLU tissue specificity: The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detected in brain, testis, ovary, liver and pancreas, and at lower levels in kidney, heart, spleen and lung. .
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human Clusterin |
| Format | 8x12 divisible strips |
| Reactivities | Human |
CLU CRISPRa kit - CRISPR gene activation of human clusterin
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Clu CRISPRa kit - CRISPR gene activation of mouse clusterin
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CLU
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene CLU
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Clu
| Application | Plasmid of exact quantity for transcript copy number calculation |
CLU MS Standard C13 and N15-labeled recombinant protein (NP_001822)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of clusterin (CLU) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-CLU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CLU |
Clusterin alpha chain Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human Clusterin alpha chain (NP_001822.3). |
| Modifications | Unmodified |
Clusterin alpha chain Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1). |
| Modifications | Unmodified |
CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of CLU (NM_203339) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLU (NM_001831) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLU (NM_001171138) in HEK293T cells paraffin embedded controls for ICC/IHC staining
CLU - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Clu - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Clu - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- CLU