Germany
Japan
United Kingdom
China
EIF4G1 (Myc-DDK tagged) - Homo sapiens eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadEIF4G1 (myc-DDK-tagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EIF4G1 (GFP-tagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EIF4G1 (GFP-tagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EIF4G1 (GFP-tagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EIF4G1 (GFP-tagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EIF4G1 (GFP-tagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EIF4G1 (GFP-tagged) - Homo sapiens eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of EIF4G1 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
EIF4G1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
EIF4G1 (untagged)-Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 5
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-EIF4G1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G1 antibody: synthetic peptide directed towards the middle region of human EIF4G1. Synthetic peptide located within the following region: PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ |
Lenti ORF clone of Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 5, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of EIF4G1 (mGFP-tagged)-Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
EIF4G1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
EIF4G1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
EIF4G1 CRISPRa kit - CRISPR gene activation of human eukaryotic translation initiation factor 4 gamma 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Eif4g1 CRISPRa kit - CRISPR gene activation of mouse eukaryotic translation initiation factor 4, gamma 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene EIF4G1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
EIF4G1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Eif4g1 (untagged) - Mouse eukaryotic translation initiation factor 4, gamma 1 (Eif4g1), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Eif4g1 (untagged) - Mouse eukaryotic translation initiation factor 4, gamma 1 (Eif4g1), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Eif4g1
EIF4G1 MS Standard C13 and N15-labeled recombinant protein (NP_004944)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
EIF4G1 MS Standard C13 and N15-labeled recombinant protein (NP_937884)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
EIF4G1 (GFP-tagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 8
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
3`UTR clone of eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) transcript variant 4 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) transcript variant 3 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) transcript variant 5 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
EIF4G1 (untagged)-Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
EIF4G1 (untagged)-Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
EIF4G1 (untagged)-Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
EIF4G1 (untagged)-Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
EIF4G1 (untagged) - Homo sapiens eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 7
| Vector | pCMV6 series |
| Tag | Tag Free |
EIF4G1 (untagged) - Human eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1), transcript variant 8
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Eif4g1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
EIF4G Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G (NP_886553.3). |
| Modifications | Unmodified |
EIF4G1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3). |
| Modifications | Unmodified |
Phospho-EIF4G1-S1108 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S1108 of human EIF4G1 (NP_001181875.1). |
| Modifications | Phospho S1108 |
EIF4G1 (phospho-S1148) polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to residues in Human EIF4G1 around the phosphorylation site of S1148. |
Transient overexpression of EIF4G1 (NM_004953) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EIF4G1 (NM_198241) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- EIF4G1