Lenti ORF clone of Gpx4 (mGFP-tagged ORF) - Rat glutathione peroxidase 4 (Gpx4), transcript variant 1, (10 ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gpx4 (GFP-tagged ORF) - Rat glutathione peroxidase 4 (Gpx4), transcript variant 1, (Note: selenocysteine protein, Internal stop codon present. see reference data summary below), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Mammalian Cell Selection | Puromycin |
Glutathione Peroxidase 4 (184-196) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEPLVIEKDLPHY, from the C-Terminus of protein sequence according to NP_002076.2NP_001034937.1. |
Lenti-ORF, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-AC |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GPX4 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-XL5 |
| Mammalian Cell Selection | None |
GPX4 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Gpx4 (untagged) - Mouse glutathione peroxidase 4 (Gpx4), transcript variant 2, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti-ORF clone of GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
GPX4 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Gpx4 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Purified recombinant protein of Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, Gly73-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
qSTAR qPCR primer pairs against Homo sapiens gene GPX4
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
USD 121.00
2 Weeks
GPX4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal Glutathione Peroxidase 4 antibody
| Applications | WB |
| Reactivities | Guinea Pig, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse GPx4 protein. |
Gpx4 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
GPX4 CRISPRa kit - CRISPR gene activation of human glutathione peroxidase 4
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gpx4 CRISPRa kit - CRISPR gene activation of mouse glutathione peroxidase 4
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GPX4
| Application | Plasmid of exact quantity for transcript copy number calculation |
Gpx4 (untagged) - Mouse glutathione peroxidase 4 (cDNA clone MGC:118087 IMAGE:4936866), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
Gpx4 (untagged) - Mouse glutathione peroxidase 4 (Gpx4), transcript variant 1, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Gpx4
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Gpx4 (untagged ORF) - Rat glutathione peroxidase 4 (Gpx4), transcript variant 2, (Note, selenocysteine protein, internal stop codon, see reference data summary)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
Gpx4 (untagged ORF) - Rat glutathione peroxidase 4 (Gpx4), transcript variant 1, (Note, selenocysteine protein, internal stop codon, see reference data summary)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4) transcript variant 3 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6 series |
Gpx4 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GPX4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of human GPX4 (NP_002076.2). |
| Modifications | Unmodified |
Transient overexpression of GPX4 (NM_002085) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPX4 (NM_001039847) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPX4 (NM_001039848) in HEK293T cells paraffin embedded controls for ICC/IHC staining
GPX4 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
USD 1,395.00
5 Weeks
GPX4 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Gpx4 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Gpx4 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Gpx4 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Gpx4 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Gpx4 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of GPX4 (NM_002085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPX4 (NM_002085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GPX4 (NM_001039847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GPX4 (NM_001039848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Germany
Japan
United Kingdom
China
