Products

View as table Download

Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Grk6 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk6 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Grk6 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Grk6 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal anti-GRK6 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GRK6.

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GRK6 (untagged)-Kinase deficient mutant (K215M) of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

GRK6 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Rabbit Polyclonal GRK6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRK6 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human GRK6.

GRK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GRK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

GRK6 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-GRK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK6 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK6. Synthetic peptide located within the following region: LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL

GRK6 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor kinase 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Grk6 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor kinase 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene GRK6

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene GRK6

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 7

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qPCR primer pairs and template standards against Mus musculus gene Gprk6

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Grk6

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

GRK6 MS Standard C13 and N15-labeled recombinant protein (NP_001004106)

Tag C-Myc/DDK
Expression Host HEK293

Grk6 (untagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 1, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Grk6 (untagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Grk6 (untagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of G protein-coupled receptor kinase 6 (GRK6) transcript variant 3 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

3`UTR clone of G protein-coupled receptor kinase 6 (GRK6) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

3`UTR clone of G protein-coupled receptor kinase 6 (GRK6) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3

Vector pCMV6 series
Tag Tag Free

Grk6 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Grk6 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GRK6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human GRK6 (NP_001004106.1).
Modifications Unmodified

USD 1,070.00

4 Weeks

Transient overexpression of GRK6 (NM_001004106) in HEK293T cells paraffin embedded controls for ICC/IHC staining