Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Grk6 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk6 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk6 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Grk6 (mGFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Grk6 (GFP-tagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of G protein-coupled receptor kinase 6 (GRK6), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-GRK6 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GRK6. |
Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GRK6 (untagged)-Kinase deficient mutant (K215M) of Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
GRK6 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal GRK6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GRK6 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human GRK6. |
GRK6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GRK6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of G protein-coupled receptor kinase 6 (GRK6), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 1, (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GRK6 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
Format | Retroviral plasmids |
Vector | pRFP-C-RS |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GRK6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK6 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK6. Synthetic peptide located within the following region: LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL |
GRK6 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor kinase 6
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Grk6 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor kinase 6
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GRK6
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GRK6
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 7
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 6
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Grk6 (untagged) - Mouse G protein-coupled receptor kinase 6 (Grk6), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Gprk6
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Grk6
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
GRK6 MS Standard C13 and N15-labeled recombinant protein (NP_001004106)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Grk6 (untagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 1, (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Grk6 (untagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 3, (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Grk6 (untagged ORF) - Rat G protein-coupled receptor kinase 6 (Grk6), transcript variant 2, (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of G protein-coupled receptor kinase 6 (GRK6) transcript variant 3 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of G protein-coupled receptor kinase 6 (GRK6) transcript variant 2 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of G protein-coupled receptor kinase 6 (GRK6) transcript variant 1 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
GRK6 (untagged)-Human G protein-coupled receptor kinase 6 (GRK6), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Grk6 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Grk6 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GRK6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human GRK6 (NP_001004106.1). |
Modifications | Unmodified |
Transient overexpression of GRK6 (NM_001004106) in HEK293T cells paraffin embedded controls for ICC/IHC staining