Products

cDNA Clones (100)
Proteins (57)
Antibodies (29)
RNAi (9)
Gene Expression (8)
Jump to Filters
View as table Download
Ribonuclease Inhibitor (RNH1) (NM_002939) Human Tagged ORF Clone Lentiviral Particle
RC208360L3V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (Myc-DDK tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_002939) Human Tagged ORF Clone Lentiviral Particle
RC208360L4V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (mGFP-tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203385) Human Tagged ORF Clone Lentiviral Particle
RC213589L3V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (Myc-DDK-tagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203385) Human Tagged ORF Clone Lentiviral Particle
RC213589L4V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (mGFP-tagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203387) Human Tagged ORF Clone Lentiviral Particle
RC213642L3V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (Myc-DDK tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203387) Human Tagged ORF Clone Lentiviral Particle
RC213642L4V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (mGFP-tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203386) Human Tagged ORF Clone Lentiviral Particle
RC218365L3V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (Myc-DDK-tagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203386) Human Tagged ORF Clone Lentiviral Particle
RC218365L4V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (mGFP-tagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203389) Human Tagged ORF Clone Lentiviral Particle
RC219235L3V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (Myc-DDK tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 8, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203389) Human Tagged ORF Clone Lentiviral Particle
RC219235L4V

USD 820.00

6 Weeks

Lenti ORF particles, RNH1 (mGFP-tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 8, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_203383) Human Tagged ORF Clone
RG200082

USD 460.00

3 Weeks

RNH1 (GFP-tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ribonuclease Inhibitor (RNH1) (NM_203385) Human Tagged ORF Clone
RG213589

USD 460.00

3 Weeks

RNH1 (GFP-tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ribonuclease Inhibitor (RNH1) (NM_203386) Human Tagged ORF Clone
RG218365

USD 460.00

3 Weeks

RNH1 (GFP-tagged) - Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rnh1 (NM_139105) Rat Tagged ORF Clone
RR215630

USD 610.00

4 Weeks

LOC100360501 (Myc-DDK-tagged ORF) - Rat ribonuclease/angiogenin inhibitor 1 (Rnh1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rnh1 (NM_139105) Rat Tagged ORF Clone
RR215630L3

USD 810.00

10 Weeks

Lenti ORF clone of LOC100360501 (Myc-DDK-tagged ORF) - Rat ribonuclease/angiogenin inhibitor 1 (Rnh1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rnh1 (NM_139105) Rat Tagged ORF Clone Lentiviral Particle
RR215630L3V

USD 1,040.00

14 Weeks

Lenti ORF particles, LOC100360501 (Myc-DDK-tagged ORF) - Rat ribonuclease/angiogenin inhibitor 1 (Rnh1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rnh1 (NM_139105) Rat Tagged ORF Clone
RR215630L4

USD 900.00

10 Weeks

Lenti ORF clone of LOC100360501 (mGFP-tagged ORF) - Rat ribonuclease/angiogenin inhibitor 1 (Rnh1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rnh1 (NM_139105) Rat Tagged ORF Clone Lentiviral Particle
RR215630L4V

USD 1,150.00

14 Weeks

Lenti ORF particles, LOC100360501 (GFP-tagged ORF) - Rat ribonuclease/angiogenin inhibitor 1 (Rnh1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rnh1 (NM_001270763) Rat Tagged ORF Clone
RR216708

USD 460.00

3 Weeks

Rnh1 (myc-DDK-tagged) - Rat ribonuclease/angiogenin inhibitor 1 (Rnh1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rnh1 (NM_001270762) Rat Tagged ORF Clone
RR216783

USD 490.00

3 Weeks

Rnh1 (myc-DDK-tagged) - Rat ribonuclease/angiogenin inhibitor 1 (Rnh1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rnh1 (NM_145135) Mouse Tagged Lenti ORF Clone
MR207287L1

USD 780.00

In Stock

Lenti ORF clone of Rnh1 (Myc-DDK-tagged) - Mouse ribonuclease/angiogenin inhibitor 1 (Rnh1), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Ribonuclease Inhibitor (RNH1) (NM_002939) Human Untagged Clone
SC118285

USD 310.00

In Stock

RNH1 (untagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Ribonuclease Inhibitor (RNH1) (NM_002939) Human Untagged Clone
SC323997

USD 310.00

In Stock

RNH1 (untagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody
TA344582

USD 475.00

5 Days

Rabbit Polyclonal Anti-RNH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: RELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNN
Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody
TA344583

USD 475.00

5 Days

Rabbit Polyclonal Anti-RNH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: LLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG
Rnh1 (NM_145135) Mouse Tagged ORF Clone
MR207287L2

USD 630.00

3 Weeks

Lenti ORF clone of Rnh1 (mGFP-tagged) - Mouse ribonuclease/angiogenin inhibitor 1 (Rnh1), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody
TA324489

USD 512.00

5 Days

Rabbit polyclonal RNH1 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RNH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 425-454 amino acids from the C-terminal region of human RNH1.
Ribonuclease Inhibitor (RNH1) (NM_002939) Human Over-expression Lysate
LY401028

USD 396.00

5 Days

Transient overexpression lysate of ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Ribonuclease Inhibitor (RNH1) (NM_203389) Human Untagged Clone
SC121226

USD 760.00

In Stock

RNH1 (untagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 8

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Ribonuclease Inhibitor (RNH1) (NM_203383) Human Untagged Clone
SC320211

USD 760.00

In Stock

RNH1 (untagged)-Human ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
RNH1 Human siRNA Oligo Duplex (Locus ID 6050)
SR304087

USD 430.00

In Stock

RNH1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Ribonuclease Inhibitor (RNH1) (NM_203388) Human Over-expression Lysate
LY404329

USD 396.00

5 Days

Transient overexpression lysate of ribonuclease/angiogenin inhibitor 1 (RNH1), transcript variant 7

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody
TA330921

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ
Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI4G4]
CF501874

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]
CF501875

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications FC, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated
Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI2B1]
CF501965

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: OTI1B7]
CF501981

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RNH1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Human Ribonuclease Inhibitor (RNH1) activation kit by CRISPRa
GA104123

USD 1,290.00

2 Weeks

RNH1 CRISPRa kit - CRISPR gene activation of human ribonuclease/angiogenin inhibitor 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector