Germany
Japan
United Kingdom
China
Human TREM2 ELISA Kit 1 x 96
| Assay Type | Sandwich |
| Sensitivity | 25pg/ml |
| Sample Type | Human serum, plasma and other biological fluids. |
Products
View as table Download
TREM2 CRISPRa kit - CRISPR gene activation of human triggering receptor expressed on myeloid cells 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Trem2 CRISPRa kit - CRISPR gene activation of mouse triggering receptor expressed on myeloid cells 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene TREM2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene TREM2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene TREM2
TREM2 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
TREM2 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
TREM2 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
qPCR primer pairs and template standards against Mus musculus gene Trem2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Trem2
Lenti ORF clone of Trem2 (Myc-DDK-tagged) - Mouse triggering receptor expressed on myeloid cells 2 (Trem2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Trem2 (untagged ORF) - Rat triggering receptor expressed on myeloid cells 2 (Trem2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of triggering receptor expressed on myeloid cells 2 (TREM2) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
TREM2 (untagged) - Homo sapiens triggering receptor expressed on myeloid cells 2 (TREM2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-TREM2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TREM2 |
TREM2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1). |
| Modifications | Unmodified |
TREM2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS |
TREM2 R47H Rabbit monoclonal antibody,clone OTIR4F7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TREM2 Rabbit monoclonal antibody,clone OTIR3B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TREM2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length human recombinant protein of human TREM2 (NP_061838) produced in Expi 293F. |
TREM2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length human recombinant protein of human TREM2 (NP_061838) produced in Expi 293F. |
Transient overexpression of TREM2 (NM_018965) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TREM2 (NM_001271821) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Trem2 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Trem2 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human triggering receptor expressed on myeloid cells 2 (TREM2), Met1-Ser174, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug
| Tag | C-HIS |
| Expression Host | HEK293 |
Purified recombinant protein of Human triggering receptor expressed on myeloid cells 2 (TREM2), 19His-174Ser, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
TREM2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Trem2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Trem2 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of TREM2 (NM_018965) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TREM2 (NM_018965) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TREM2 (NM_001271821) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TREM2