Germany
Japan
United Kingdom
China
PPARG - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Products
View as table Download
Pparg - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
PPARG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPARG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPARG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPARG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPARG (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR321378 is the updated version of SR303655.
Rabbit anti-PPARG polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein |
Rabbit polyclonal PPAR Gamma 2 antibody
| Applications | WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the amino terminus of human PPAR gamma 2. |
Rabbit Polyclonal Phospho-PPAR- gamma (Ser112) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR- gamma around the phosphorylation site of Serine 112 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI |
Pparg - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Pparg - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
PPAR gamma (PPARG) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human PPAR-G |
qPCR primer pairs and template standards against Homo sapiens gene PPARG
| Application | Plasmid of exact quantity for transcript copy number calculation |
Pparg - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
3`UTR clone of peroxisome proliferator-activated receptor gamma (PPARG) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
PPAR-gamma (209-477, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PPAR-gamma (209-477, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PPARG CRISPRa kit - CRISPR gene activation of human peroxisome proliferator activated receptor gamma
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pparg CRISPRa kit - CRISPR gene activation of mouse peroxisome proliferator activated receptor gamma
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PPARG
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene PPARG
| Application | Plasmid of exact quantity for transcript copy number calculation |
Pparg - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 mBFP-Neo donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
Pparg - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 Luciferase-Puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
Pparg - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 RFP-BSD donor, 1 scramble control |
| Donor DNA | RFP-BSD |
qPCR primer pairs and template standards against Mus musculus gene Pparg
| Application | Plasmid of exact quantity for transcript copy number calculation |
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Pparg (untagged ORF) - Rat peroxisome proliferator-activated receptor gamma (Pparg), transcript variant 2, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pparg (untagged) - Rat peroxisome proliferator-activated receptor gamma (Pparg), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of peroxisome proliferator-activated receptor gamma (PPARG) transcript variant 4 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of peroxisome proliferator-activated receptor gamma (PPARG) transcript variant 3 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPARG (untagged)-Human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pparg (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
SR427030 is the updated version of SR416244.
Anti-PPARG Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma |
PPARγ Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 70-170 of human PPARγ (NP_056953.2). |
| Modifications | Unmodified |
PPARγ Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARγ |
PPARG (Phospho-T166) polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human PPARG around the phosphorylation site of Threonine 166. |
Transient overexpression of PPARG (NM_138712) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPARG (NM_138711) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- PPARG
Filter by
Species
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
- pLenti-C-Myc-DDK-P2A-Puro (16)
- pCMV6-Entry (15)
- pLenti-C-mGFP-P2A-Puro (15)
- pLenti-C-Myc-DDK (10)
- pLenti-C-mGFP (9)
- pCMV6-AC-GFP (6)
- pGFP-C-shLenti (6)
- pCMV6-XL4 (3)
- pGFP-V-RS (3)
- pRS (3)
- EF1a-GFP-P2A-Puro (1)
- GFP-puro (1)
- Luciferase-Puro (1)
- PCMV6-Kan/Neo (1)
- RFP-BSD (1)
- mBFP-Neo (1)
- pCMV6-AC (1)
- pCMV6-XL5 (1)
- pRFP-C-RS (1)