Products

cDNA Clones (17)
Proteins (16)
Antibodies (7)
Jump to Filters
View as table Download
TJP1
AB0054-200

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.
TJP1 (NM_003257) Human Tagged ORF Clone
RC222836

USD 1,840.00

In Stock

TJP1 (Myc-DDK-tagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TJP1 (NM_003257) Human Tagged ORF Clone Lentiviral Particle
RC222836L1V

USD 2,240.00

3 Weeks

Lenti ORF particles, TJP1 (Myc-DDK tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TJP1 (NM_003257) Human Tagged ORF Clone
RG222836

USD 2,020.00

In Stock

TJP1 (GFP-tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TJP1 (NM_175610) Human Tagged ORF Clone
RC216224

USD 1,450.00

In Stock

TJP1 (Myc-DDK-tagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TJP1 (NM_001301026) Human Tagged ORF Clone
RC240200

USD 1,780.00

In Stock

TJP1 (myc-DDK-tagged) - Human tight junction protein 1 (TJP1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TJP1 (NM_003257) Human Tagged ORF Clone
RC222836L3

USD 2,040.00

In Stock

Lenti ORF clone of Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TJP1 (NM_003257) Human Tagged ORF Clone Lentiviral Particle
RC222836L3V

USD 2,240.00

In Stock

Lenti ORF particles, TJP1 (Myc-DDK tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TJP1 (NM_001301025) Human Tagged ORF Clone
RC240215

USD 1,930.00

7 Weeks

TJP1 (myc-DDK-tagged) - Human tight junction protein 1 (TJP1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TJP1 (NM_175610) Human Tagged ORF Clone
RG216224

USD 1,600.00

3 Weeks

TJP1 (GFP-tagged) - Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TJP1 (NM_003257) Human Tagged ORF Clone
RC222836L1

USD 2,520.00

In Stock

Lenti ORF clone of Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TJP1 Rabbit Polyclonal Antibody
TA341679

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
TJP1 Rabbit Polyclonal Antibody
TA308455

USD 415.00

5 Days

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 296 of ZO-1 (Uniprot ID#Q07157)
TJP1 (NM_003257) Human Over-expression Lysate
LC418804

USD 187.00

4 Weeks

TJP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TJP1 (NM_003257) Human Over-expression Lysate
LY418804

USD 605.00

In Stock

Transient overexpression lysate of tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TJP1 (NM_003257) Human Untagged Clone
SC127835

USD 2,820.00

In Stock

TJP1 (untagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC127835 is the updated version of SC120780.
TJP1 Rabbit Polyclonal Antibody
TA347889

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ZO 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZO 1 Antibody: A synthesized peptide derived from human ZO 1
TJP1 Goat Polyclonal Antibody
TA311262

USD 375.00

5 Days

Goat Anti-ZO1 Tight Junction Protein Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PKPTSQNQFSEHDKT, from the internal region of the protein sequence according to NP_003248.3; NP_783297.2.
TJP1 Rabbit Polyclonal Antibody
TA354917

USD 355.00

2 Weeks

Rabbit anti ZO-1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TJP1 Rabbit Polyclonal Antibody
TA308472

USD 415.00

5 Days

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1574 and 1748 of ZO-1 (Uniprot ID#Q07157)
TJP1 (NM_175610) Human Mass Spec Standard
PH316224

USD 2,055.00

3 Weeks

TJP1 MS Standard C13 and N15-labeled recombinant protein (NP_783297)

Tag C-Myc/DDK
Expression Host HEK293
TJP1 (NM_003257) Human Mass Spec Standard
PH322836

USD 2,055.00

3 Weeks

TJP1 MS Standard C13 and N15-labeled recombinant protein (NP_003248)

Tag C-Myc/DDK
Expression Host HEK293
TJP1 (NM_001301026) Human Tagged ORF Clone
RG240200

USD 1,820.00

2 Weeks

TJP1 (GFP-tagged) - Human tight junction protein 1 (TJP1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TJP1 (NM_001301025) Human Tagged ORF Clone
RG240215

USD 1,970.00

2 Weeks

TJP1 (GFP-tagged) - Human tight junction protein 1 (TJP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TJP1 (NM_175610) Human Untagged Clone
SC309896

USD 3,380.00

2 Weeks

TJP1 (untagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
SC309896 is the updated version of SC120781.
TJP1 (NM_003257) Human Untagged Clone
SC318666

USD 2,820.00

3 Weeks

TJP1 (untagged)-Human tight junction protein 1 (zona occludens 1) (TJP1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TJP1 (NM_001301026) Human Untagged Clone
SC338094

USD 1,720.00

6 Weeks

TJP1 (untagged) - Human tight junction protein 1 (TJP1), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TJP1 (NM_001301025) Human Untagged Clone
SC338109

USD 1,850.00

7 Weeks

TJP1 (untagged) - Human tight junction protein 1 (TJP1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TJP1 ICC Control Block
TB416224

USD 2,100.00

4 Weeks

Transient overexpression of TJP1 (NM_175610) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TJP1 ICC Control Block
TB422836

USD 2,490.00

4 Weeks

Transient overexpression of TJP1 (NM_003257) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TJP1 ICC Control Block
TB440200

USD 2,430.00

4 Weeks

Transient overexpression of TJP1 (NM_001301026) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TJP1 ICC Control Block
TB440215

USD 2,580.00

4 Weeks

Transient overexpression of TJP1 (NM_001301025) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TJP1 Cytosection
TS416224

USD 225.00

4 Weeks

Transient overexpression of TJP1 (NM_175610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TJP1 Cytosection
TS416224P5

USD 889.00

4 Weeks

Transient overexpression of TJP1 (NM_175610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TJP1 Cytosection
TS422836

USD 225.00

4 Weeks

Transient overexpression of TJP1 (NM_003257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TJP1 Cytosection
TS422836P5

USD 889.00

4 Weeks

Transient overexpression of TJP1 (NM_003257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TJP1 Cytosection
TS440200

USD 225.00

4 Weeks

Transient overexpression of TJP1 (NM_001301026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TJP1 Cytosection
TS440200P5

USD 889.00

4 Weeks

Transient overexpression of TJP1 (NM_001301026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TJP1 ICC Control Sections
TS440215P5

USD 889.00

4 Weeks

Transient overexpression of TJP1 (NM_001301025) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack