WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, WASF1 (Myc-DDK tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, WASF1 (Myc-DDK tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal WAVE1 (Tyr125) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V). |
Modifications | Phospho-specific |
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal WAVE1 (Ab-125) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V). |
WASF1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
WASF1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse monoclonal WAVE1/SCAR Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of WAS protein family, member 1 (WASF1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of WAS protein family, member 1 (WASF1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
WASF1 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP |
Transient overexpression of WASF1 (NM_001024934) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_003931) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_001024936) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_001024935) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_001024934) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WASF1 (NM_001024934) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WASF1 (NM_003931) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WASF1 (NM_003931) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WASF1 (NM_001024936) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WASF1 (NM_001024936) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack