Germany
Japan
United Kingdom
China
LEP (Myc-DDK-tagged)-Human leptin (LEP)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, LEP (Myc-DDK tagged) - Human leptin (LEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, LEP (mGFP-tagged) - Human leptin (LEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human leptin (LEP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human leptin (LEP), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
LEP (GFP-tagged) - Human leptin (LEP)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, LEP (Myc-DDK tagged) - Human leptin (LEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, LEP (mGFP-tagged) - Human leptin (LEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human leptin (LEP), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Transient overexpression lysate of leptin (LEP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Purified recombinant protein of Human leptin (LEP).
| Tag | Tag Free |
| Expression Host | E. coli |
Rabbit anti-LEP Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LEP |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the middle region of human LEP. Synthetic peptide located within the following region: LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM |
Mouse Monoclonal Leptin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Leptin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Lenti ORF clone of Human leptin (LEP), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
LEP MS Standard C13 and N15-labeled recombinant protein (NP_000221)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit polyclonal anti-Leptin antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant rat Leptin |
Leptin human recombinant protein, 0.5 mg
| Expression Host | E. coli |
Leptin human recombinant protein, 0.1 mg
| Expression Host | E. coli |
LEP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Anti-LEP Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Transient overexpression of LEP (NM_000230) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human leptin (LEP)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human leptin (LEP)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human leptin (LEP)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human leptin (LEP)
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of LEP (NM_000230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LEP (NM_000230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LEP
Pathways
- Adipocytokine signaling pathway