Germany
Japan
United Kingdom
China
ATF6 (Myc-DDK-tagged)-Human activating transcription factor 6 (ATF6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, ATF6 (Myc-DDK-tagged)-Human activating transcription factor 6 (ATF6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ATF6 (mGFP-tagged)-Human activating transcription factor 6 (ATF6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti-ORF clone of ATF6 (mGFP-tagged)-Human activating transcription factor 6 (ATF6)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of ATF6 (Myc-DDK-tagged)-Human activating transcription factor 6 (ATF6)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATF6 (Myc-DDK-tagged)-Human activating transcription factor 6 (ATF6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ATF6 (mGFP-tagged)-Human activating transcription factor 6 (ATF6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ATF6 (GFP-tagged) - Human activating transcription factor 6 (ATF6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATF6 (untagged)-Human activating transcription factor 6 (ATF6)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of ATF6 (Myc-DDK-tagged)-Human activating transcription factor 6 (ATF6)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal ATF6 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ATF6 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ATF6. The immunogen is located within amino acids 30 - 80 of ATF6. |
ATF6 mouse monoclonal antibody, clone 3D5, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
ATF6 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Rabbit |
| Immunogen | Synthetic peptide from C-terminus of human ATF6 |
Lenti-ORF clone of ATF6 (mGFP-tagged)-Human activating transcription factor 6 (ATF6)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal anti-ATF6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF6 antibody: synthetic peptide directed towards the N terminal of human ATF6. Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD |
Transient overexpression of ATF6 (NM_007348) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATF6 (NM_007348) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATF6 (NM_007348) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ATF6
Pathways
- Alzheimer's disease