Germany
Japan
United Kingdom
China
TNFRSF1A (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, TNFRSF1A (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TNFRSF1A (untagged)-Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, TNFRSF1A (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, TNFRSF1A (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, TNFRSF1A (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TNFRSF1A (GFP-tagged) - Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFRSF1A (untagged)-Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 1A (sTNF-RI / TNFRSF1A)
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A).
| Tag | Tag Free |
| Expression Host | E. coli |
TNFRSF1A (20-43) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1. |
TNFRSF1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit polyclonal TNF Receptor-1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
CD120a / TNFR1 (41-201, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD120a / TNFR1 (41-201, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD120a / TNFR1 (22-211, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD120a / TNFR1 (22-211, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD120a / TNFR1 (30-211, hIgG-His tag) human protein, 0.25 mg
| Tag | hIgG-His-tag |
CD120a / TNFR1 (30-211, hIgG-His tag) human protein, 50 µg
| Tag | hIgG-His-tag |
USD 399.00
In Stock
Transient overexpression of TNFRSF1A (NM_001065) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TNFRSF1A (NM_001065) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TNFRSF1A (NM_001065) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TNFRSF1A
Pathways
- Alzheimer's disease