ARG1 (Myc-DDK-tagged)-Human arginase, liver (ARG1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ARG1 (Myc-DDK-tagged)-Human arginase, liver (ARG1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human arginase, liver (ARG1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ARG1 (untagged)-Human arginase, liver (ARG1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 820.00
2 Weeks
Lenti ORF particles, ARG1 (Myc-DDK tagged) - Human arginase, liver (ARG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ARG1 (mGFP-tagged) - Human arginase, liver (ARG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ARG1 (Myc-DDK tagged) - Homo sapiens arginase 1 (ARG1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ARG1 (GFP-tagged) - Human arginase, liver (ARG1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human arginase, liver (ARG1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, ARG1 (Myc-DDK tagged) - Human arginase, liver (ARG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
ARG1 (GFP-tagged) - Homo sapiens arginase 1 (ARG1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ARG1 (untagged)-Human arginase, liver (ARG1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of arginase, liver (ARG1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal antibody to Arginase I (arginase, liver)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089) |
Lenti ORF clone of Human arginase, liver (ARG1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,020.00
3 Weeks
Lenti ORF particles, ARG1 (mGFP-tagged) - Human arginase, liver (ARG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Arginase-1 (1-322, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Rabbit anti-ARG1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ARG1 |
Goat Anti-Arginase I Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2. |
Arginase 1 (ARG1) (1-145) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 145 of Human Arginase-1 |
Lenti ORF clone of Human arginase, liver (ARG1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal ARG1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARG1. |
Rabbit Polyclonal Anti-ARG1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK |
ARG1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ARG1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
Goat Polyclonal Antibody against ARG1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REGNHKPIDYLNPPK, from the C Terminus of the protein sequence according to NP_000036.2. |
Rabbit Polyclonal Anti-ARG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: SAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYG |
Purified recombinant protein of Human arginase, liver (ARG1)
Tag | C-His |
Expression Host | E. coli |
Arginase-1 (1-322, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI1H4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4H7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4D7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI3C8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI2E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ARG1 MS Standard C13 and N15-labeled recombinant protein (NP_000036)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ARG1 (untagged) - Homo sapiens arginase 1 (ARG1), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ARG1 mouse monoclonal antibody,clone OTI1H4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI1H4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI1H4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ARG1 mouse monoclonal antibody,clone OTI1H4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ARG1 mouse monoclonal antibody,clone OTI4H7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI4H7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ARG1 mouse monoclonal antibody,clone OTI4H7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ARG1 mouse monoclonal antibody,clone OTI4H7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ARG1 mouse monoclonal antibody,clone OTI4D7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |