Products

Antibodies (47)
Proteins (16)
cDNA Clones (14)
Jump to Filters
View as table Download
Arginase 1 (ARG1) (NM_000045) Human Untagged Clone
SC114331

USD 310.00

In Stock

ARG1 (untagged)-Human arginase, liver (ARG1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Arginase 1 (ARG1) (NM_001244438) Human Tagged ORF Clone
RC232495

USD 420.00

In Stock

ARG1 (Myc-DDK tagged) - Homo sapiens arginase 1 (ARG1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Arginase 1 (ARG1) (NM_000045) Human Tagged ORF Clone
RG204649

USD 460.00

In Stock

ARG1 (GFP-tagged) - Human arginase, liver (ARG1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Arginase 1 (ARG1) (NM_001244438) Human Tagged ORF Clone
RG232495

USD 460.00

3 Weeks

ARG1 (GFP-tagged) - Homo sapiens arginase 1 (ARG1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Arginase 1 (ARG1) (NM_000045) Human Untagged Clone
SC324527

USD 310.00

In Stock

ARG1 (untagged)-Human arginase, liver (ARG1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Arginase 1 (ARG1) (NM_000045) Human Over-expression Lysate
LY424951

USD 396.00

In Stock

Transient overexpression lysate of arginase, liver (ARG1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA308162

USD 415.00

In Stock

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)
Arginase-1 (1-322, His-tag) Human Protein
AR09474PU-N

USD 300.00

2 Weeks

Arginase-1 (1-322, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA332446

USD 275.00

3 Weeks

Rabbit anti-ARG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ARG1
Arginase 1 (ARG1) Goat Polyclonal Antibody
TA305800

USD 375.00

2 Weeks

Goat Anti-Arginase I Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2.
Arginase 1 (ARG1) (1-145) Rabbit Polyclonal Antibody
AP23580PU-N

USD 440.00

2 Weeks

Arginase 1 (ARG1) (1-145) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 145 of Human Arginase-1
Arginase 1 (ARG1) (NM_000045) Human Tagged ORF Clone
RC204649L2

USD 620.00

3 Weeks

Lenti ORF clone of Human arginase, liver (ARG1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA326119

USD 345.00

In Stock

Rabbit polyclonal ARG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARG1.
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338396

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Arginase 1 (ARG1) (NM_000045) Human Over-expression Lysate
LC424951

USD 121.00

In Stock

ARG1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338397

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Arginase 1 (ARG1) Goat Polyclonal Antibody
TA303209

USD 375.00

5 Days

Goat Polyclonal Antibody against ARG1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-REGNHKPIDYLNPPK, from the C Terminus of the protein sequence according to NP_000036.2.
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338395

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: SAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYG
Arginase 1 (ARG1) (NM_000045) Human Recombinant Protein
TP721013

USD 330.00

3 Weeks

Purified recombinant protein of Human arginase, liver (ARG1)

Tag C-His
Expression Host E. coli
Arginase-1 (1-322, His-tag) Human Protein
AR09474PU-L

USD 745.00

2 Weeks

Arginase-1 (1-322, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
CF502413

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
CF813193

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI1H4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4H7]
CF813194

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4H7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4D7]
CF813196

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4D7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4G3]
CF813197

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI4G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI3C8]
CF813198

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI3C8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI2E7]
CF813233

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody,clone OTI2E7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) (NM_000045) Human Mass Spec Standard
PH304649

USD 2,055.00

3 Weeks

ARG1 MS Standard C13 and N15-labeled recombinant protein (NP_000036)

Tag C-Myc/DDK
Expression Host HEK293
Arginase 1 (ARG1) (NM_001244438) Human Untagged Clone
SC330211

USD 340.00

3 Weeks

ARG1 (untagged) - Homo sapiens arginase 1 (ARG1), transcript variant 1

Vector pCMV6 series
Tag Tag Free
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA502413

USD 379.00

In Stock

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E6]
TA502413AM

USD 420.00

4 Weeks

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Arginase 1 (ARG1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E6]
TA502413BM

USD 420.00

4 Weeks

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA502413S

USD 159.00

In Stock

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA813193

USD 379.00

In Stock

ARG1 mouse monoclonal antibody,clone OTI1H4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA813193S

USD 159.00

2 Days

ARG1 mouse monoclonal antibody,clone OTI1H4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4D7]
TA813196

USD 379.00

In Stock

ARG1 mouse monoclonal antibody,clone OTI4D7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated