Germany
Japan
United Kingdom
China
PYCR1 (Myc-DDK-tagged)-Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PYCR1 (Myc-DDK-tagged)-Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, PYCR1 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PYCR1 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PYCR1 (GFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PYCR1 (myc-DDK-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PYCR1 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PYCR1 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PYCR1 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PYCR1 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PYCR1 (myc-DDK-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PYCR1 (myc-DDK-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PYCR1 (GFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-PYCR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE |
Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PYCR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR |
PYCR1 (1-319, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
PYCR1 (1-319, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
PYCR1 (untagged)-Human pyrroline-5-carboxylate reductase 1 (cDNA clone MGC:22061 IMAGE:4420238), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PYCR1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PYCR1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_008838)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PYCR1 (GFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PYCR1 (GFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PYCR1 (GFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PYCR1 (untagged)-Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PYCR1 (untagged)-Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PYCR1 (untagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PYCR1 (untagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PYCR1 (untagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 420.00
4 Weeks
Transient overexpression of PYCR1 (NM_006907) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PYCR1 (NM_153824) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PYCR1 (NM_001282279) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PYCR1 (NM_001282280) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- PYCR1
Pathways
- Arginine and proline metabolism