Products

cDNA Clones (43)
Proteins (23)
Antibodies (12)
RNAi (11)
Gene Expression (7)
Jump to Filters
View as table Download
PYCR1 (NM_006907) Human Tagged ORF Clone
RC210027

USD 420.00

In Stock

PYCR1 (Myc-DDK-tagged)-Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PYCR1 (NM_153824) Human Tagged ORF Clone
RC216359

USD 420.00

In Stock

PYCR1 (Myc-DDK-tagged)-Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PYCR1 (NM_006907) Human Tagged ORF Clone Lentiviral Particle
RC210027L1V

USD 820.00

3 Weeks

Lenti ORF particles, PYCR1 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PYCR1 (NM_006907) Human Tagged ORF Clone Lentiviral Particle
RC210027L2V

USD 820.00

6 Weeks

Lenti ORF particles, PYCR1 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PYCR1 (NM_153824) Human Tagged ORF Clone
RG216359

USD 460.00

In Stock

PYCR1 (GFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pycr1 (NM_144795) Mouse Tagged ORF Clone
MR204385

USD 68.00

USD 149.00

In Stock

Pycr1 (Myc-DDK-tagged) - Mouse pyrroline-5-carboxylate reductase 1 (Pycr1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PYCR1 Rabbit Monoclonal Antibody [Clone ID: OTIR1E8]
TA591038

USD 428.00

In Stock

Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PYCR1 (NM_001282280) Human Tagged ORF Clone
RC237417

USD 420.00

In Stock

PYCR1 (myc-DDK-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PYCR1 Human Gene Knockout Kit (CRISPR)
KN410027

USD 1,290.00

2 Weeks

PYCR1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN410027 is the updated version of KN210027.
Pycr1 Mouse Gene Knockout Kit (CRISPR)
KN514284

USD 1,290.00

2 Weeks

Pycr1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514284 is the updated version of KN314284.
Pycr1 (NM_144795) Mouse Tagged ORF Clone
MG204385

USD 300.00

3 Weeks

Pycr1 (GFP-tagged) - Mouse pyrroline-5-carboxylate reductase 1 (Pycr1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pycr1 (NM_144795) Mouse Tagged ORF Clone
MR204385L3

USD 500.00

3 Weeks

Lenti ORF clone of Pycr1 (Myc-DDK-tagged) - Mouse pyrroline-5-carboxylate reductase 1 (Pycr1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pycr1 (NM_144795) Mouse Tagged ORF Clone Lentiviral Particle
MR204385L3V

USD 700.00

6 Weeks

Lenti ORF particles, Pycr1 (Myc-DDK-tagged) - Mouse pyrroline-5-carboxylate reductase 1 (Pycr1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pycr1 (NM_144795) Mouse Tagged ORF Clone
MR204385L4

USD 500.00

3 Weeks

Lenti ORF clone of Pycr1 (mGFP-tagged) - Mouse pyrroline-5-carboxylate reductase 1 (Pycr1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pycr1 (NM_144795) Mouse Tagged ORF Clone Lentiviral Particle
MR204385L4V

USD 700.00

6 Weeks

Lenti ORF particles, Pycr1 (GFP-tagged) - Mouse pyrroline-5-carboxylate reductase 1 (Pycr1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_006907) Human Tagged ORF Clone
RC210027L3

USD 620.00

3 Weeks

Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_006907) Human Tagged ORF Clone Lentiviral Particle
RC210027L3V

USD 820.00

5 Weeks

Lenti ORF particles, PYCR1 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_006907) Human Tagged ORF Clone
RC210027L4

USD 620.00

3 Weeks

Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_006907) Human Tagged ORF Clone Lentiviral Particle
RC210027L4V

USD 820.00

7 Weeks

Lenti ORF particles, PYCR1 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_153824) Human Tagged ORF Clone
RC216359L3

USD 620.00

3 Weeks

Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_153824) Human Tagged ORF Clone Lentiviral Particle
RC216359L3V

USD 820.00

6 Weeks

Lenti ORF particles, PYCR1 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_153824) Human Tagged ORF Clone
RC216359L4

USD 620.00

3 Weeks

Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_153824) Human Tagged ORF Clone Lentiviral Particle
RC216359L4V

USD 820.00

6 Weeks

Lenti ORF particles, PYCR1 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 (NM_001282279) Human Tagged ORF Clone
RC237220

USD 420.00

2 Weeks

PYCR1 (myc-DDK-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PYCR1 (NM_001282281) Human Tagged ORF Clone
RC237616

USD 420.00

2 Weeks

PYCR1 (myc-DDK-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PYCR1 (NM_006907) Human Tagged ORF Clone
RG210027

USD 460.00

3 Weeks

PYCR1 (GFP-tagged) - Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pycr1 (NM_001105857) Rat Tagged ORF Clone
RR213838

USD 420.00

4 Weeks

Pycr1 (Myc-DDK-tagged ORF) - Rat pyrroline-5-carboxylate reductase 1 (Pycr1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pycr1 (NM_001105857) Rat Tagged ORF Clone
RR213838L3

USD 640.00

8 Weeks

Lenti ORF clone of Pycr1 (Myc-DDK-tagged ORF) - Rat pyrroline-5-carboxylate reductase 1 (Pycr1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pycr1 (NM_001105857) Rat Tagged ORF Clone Lentiviral Particle
RR213838L3V

USD 850.00

12 Weeks

Lenti ORF particles, Pycr1 (Myc-DDK-tagged ORF) - Rat pyrroline-5-carboxylate reductase 1 (Pycr1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pycr1 (NM_001105857) Rat Tagged ORF Clone
RR213838L4

USD 700.00

8 Weeks

Lenti ORF clone of Pycr1 (mGFP-tagged ORF) - Rat pyrroline-5-carboxylate reductase 1 (Pycr1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pycr1 (NM_001105857) Rat Tagged ORF Clone Lentiviral Particle
RR213838L4V

USD 960.00

12 Weeks

Lenti ORF particles, Pycr1 (GFP-tagged ORF) - Rat pyrroline-5-carboxylate reductase 1 (Pycr1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PYCR1 Rabbit Polyclonal Antibody
TA344624

USD 475.00

5 Days

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE
PYCR1 (NM_006907) Human Tagged Lenti ORF Clone
RC210027L1

USD 768.00

In Stock

Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Pycr1 Mouse qPCR Primer Pair (NM_144795)
MP212260

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Pycr1

PYCR1 Rabbit Polyclonal Antibody
TA344625

USD 475.00

5 Days

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR
PYCR1 Human siRNA Oligo Duplex (Locus ID 5831)
SR303931

USD 430.00

In Stock

PYCR1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PYCR1 (1-319, His-tag) Human Protein
AR09751PU-L

USD 1,105.00

2 Weeks

PYCR1 (1-319, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PYCR1 (1-319, His-tag) Human Protein
AR09751PU-N

USD 415.00

2 Weeks

PYCR1 (1-319, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Pycr1 (NM_144795) Mouse Untagged Clone
MC200392

USD 210.00

In Stock

Pycr1 (untagged) - Mouse pyrroline-5-carboxylate reductase 1 (Pycr1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PYCR1 (BC022244) Human Untagged Clone
SC126267

USD 310.00

In Stock

PYCR1 (untagged)-Human pyrroline-5-carboxylate reductase 1 (cDNA clone MGC:22061 IMAGE:4420238), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PYCR1 (C-term) Rabbit Polyclonal Antibody
AP53528PU-N

USD 450.00

2 Weeks

PYCR1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 290-319aa) of human PYCR1.
PYCR1 (NM_006907) Human Tagged ORF Clone
RC210027L2

USD 620.00

3 Weeks

Lenti ORF clone of Human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PYCR1 (NM_153824) Human Over-expression Lysate
LY406968

USD 396.00

5 Days

Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PYCR1 Mouse Monoclonal Antibody [Clone ID: OTI4F2]
CF811756

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PYCR1 mouse monoclonal antibody,clone OTI4F2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human PYCR1 activation kit by CRISPRa
GA103966

USD 1,290.00

2 Weeks

PYCR1 CRISPRa kit - CRISPR gene activation of human pyrroline-5-carboxylate reductase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Pycr1 activation kit by CRISPRa
GA212908

USD 1,290.00

2 Weeks

Pycr1 CRISPRa kit - CRISPR gene activation of mouse pyrroline-5-carboxylate reductase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PYCR1 Human qPCR Primer Pair (NM_006907)
HP209757

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PYCR1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
PYCR1 (NM_153824) Human Over-expression Lysate
LC406968

USD 121.00

2 Weeks

PYCR1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PYCR1 (NM_006907) Human Over-expression Lysate
LC416328

USD 121.00

2 Weeks

PYCR1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB